KEGG   Penicillium chrysogenum: Pc21g11540Help
Entry
Pc21g11540        CDS       T01091                                 

Definition
Pc21g11540
Orthology
K05351  
D-xylulose reductase [EC:1.1.1.9]
Organism
pcs  Penicillium chrysogenum
Pathway
Pentose and glucuronate interconversions
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:pcs00040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 354 aa AA seqDB search
MATAQNLSFVLEGIHKVKFEDRPVPELKNPHDVIINVKYTGICGSDVHYWEHGSIGSFVV
KDPMVLGHESAGIVSQVGSAVKTLKVGDRVAMEPGISCRRCDPCKAGKYNLCEDMRFAAT
PPYDGTLAKYYALPEDFCYKLPEHISLQEGALMEPLSVAVHIVRQAGVSPGQTVVVFGAG
PVGLLCCAVATAFGASKVIAVDIQQQRLDFAKSYATTSTFMPSNVAAVENAERMKEENGL
GAGADVAIDASGAEPSVHTGIHVLRNGGTYVQGGMGRSEILFPIMAACSKELTIKGSFRY
GSGDYKLAVGLVSSGKVDVKRLITGTVKFEQAEQAFIEVKAGKGIKTLIGGIDV
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggccacagctcagaacctttcattcgtccttgagggaattcacaaggtcaagtttgaa
gaccgcccagttcctgagctgaagaacccccacgatgtgatcatcaatgtcaagtacacc
ggtatttgcggcagtgatgtgcactactgggaacatggctcaatcggttcattcgttgtg
aaagaccccatggtcctcggacacgagtcagcaggcatcgtcagccaagtcggatcagcc
gtcaagactctaaaggtgggcgaccgggtcgccatggagcccggcatctcatgccgccga
tgcgacccctgcaaggccggaaagtacaacctgtgcgaggacatgcgcttcgccgcgacc
ccgccctacgacggcaccctcgccaaatactatgctcttcccgaggacttctgctacaag
cttcccgaacacatctccctgcaggagggagcgctcatggaacccctcagtgttgcagtg
cacatcgtgcgccaagccggtgtcagccccggccagacggtggttgtattcggtgccggc
cccgtgggcttgctgtgctgcgccgtggcgactgcgtttggcgcctccaaggtcatcgcc
gtggatatccagcagcagcgtcttgactttgccaagagctacgccacaacgtcgacgttc
atgcccagcaatgttgcggccgttgagaatgctgagcgcatgaaggaagagaacgggctc
ggcgctggtgctgatgtggcgattgacgcttcgggcgcggagccttccgtgcacacaggt
atccatgtcctacgtaacggaggcacatacgtccagggtggcatgggccgcagcgagatc
ctgttccccatcatggcggcttgttccaaggagctgaccatcaagggtagcttccggtat
ggtagcggagactacaagcttgctgttggcctggtttcatccggcaaggtcgatgttaag
aggttgattaccggcacagtgaagttcgaacaagctgagcaggcctttatcgaggtgaag
gctggcaagggcattaagaccttgattggtggtattgatgtgtaa

DBGET integrated database retrieval system