KEGG   Penicillium chrysogenum: Pc21g12620Help
Entry
Pc21g12620        CDS       T01091                                 

Definition
Pc21g12620
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pcs  Penicillium chrysogenum
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pcs00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 672 aa AA seqDB search
MCGISAFLCHPGKASSNEQANAQTRHVVDELEHSLDLVGHRGPDARGHIDILTIGLGHVR
LSIIDLSLSGNQPFHDQDNSIHAVVNGELYDHEYYRDQLASEFQFVGTSDCEIVIALYKH
YGLSFISHLRGEFAFVLWDANRQLLIAARDRYGIKSLYYTVVQGKLLVATEIKSFLAFGL
QPEWCVRTLRDQSWRIESRTFFKGVHRVLPGHYLISRPNEREEQKPYWDLEYPDKLSHDA
RSEEEIVQGVRKRLLEAVKIRLKADVPVAIYLSGGIDSSSVAGMVADLMRQGTKLGNESN
SVPSNMKCFTVQFDEDSGADESAIARRTANWLGVDIHLVKMDEEALASRFEDAVWHSEIP
LPDLNGMGRLALAEAVHAQGIKVVITGEGSDEHFAGYDAFRADLLSEPDHSWPALQLPET
DRQKALAMAAKQVKYGIFGEYSETVPDATKRMLNHSHVTSTIARVGSLPFSNWTTSYGND
LPETSLIEGFDGRVRDNITKRWHPLHTAQYLFTKSFMPHFILRYNGDNIDMVNQVESRCP
FLDHHLTEYVNNVPPSLKLKYLPEEKSFREKYILREAVKPYVTDEIYNISKKAYMGPRKF
WPGGPLHRKIKQLVTKENVESLGFVDWNATQEAVEKAFTKQDPMGLRRTITVAQFIVLGK
RFGVKPAGALPN
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaataagtgcatttctgtgtcaccctggcaaagctagctcaaatgagcaggcc
aatgcccaaacccggcatgtggtagacgaattggagcacagcctggaccttgtcggccat
cgtggaccagatgctcgtgggcatattgatatcctcacaataggccttggtcatgttcga
ctgtcaatcattgatctcagcctcagtggaaaccagccatttcacgatcaagacaacagc
attcacgcagttgtcaatggtgagctctatgaccacgaatattaccgagaccagttagcc
agcgaattccagtttgtgggaaccagtgactgcgaaatcgtcattgccttgtacaaacat
tacggcctctcttttatttcccacttgaggggagagtttgcctttgtgctctgggatgca
aaccgccagttactcatagccgctagagaccgctatggaatcaaatcactctattacaca
gtggtccaaggaaagttattggtggccacagagatcaagtctttcttggcatttgggtta
cagccggaatggtgtgtacgaacattgcgagaccagagctggagaattgaatctcgcacg
ttttttaaaggcgtacacagggttctcccggggcactatctgataagtcgccccaatgag
agagaagaacaaaagccatactgggatcttgagtaccccgataagttatcccatgatgcg
cgatccgaagaagaaattgtgcaaggagttagaaaacgtcttctggaagctgtgaagatt
cgcctgaaggcggatgttcccgtggctatctacctcagtggcggaatagactcatcatcg
gtcgctgggatggtagccgatctcatgagacaggggacaaagctagggaacgagtccaat
tcagttccatcgaacatgaaatgctttaccgttcagttcgatgaagatagcggtgcagac
gagtccgcaattgctcggcgcacagcgaattggctaggtgtcgatatccatctcgttaaa
atggacgaagaggcactcgcgtcacgctttgaggatgccgtttggcacagtgaaatccct
ctccccgatctcaacggaatgggtcggttggcactggcggaagcggtacacgctcagggc
atcaaggtcgttatcactggggagggatctgatgagcattttgcgggctacgacgcgttc
agagccgatttgcttagcgagcctgatcattcatggccagcgctacaactcccggagaca
gaccgccagaaagcgctggctatggctgcgaaacaagtcaaatacggtatattcggcgag
tacagtgagactgtcccagatgcgacgaagcgcatgctgaaccacagccatgtcactagt
accatcgcaagagttggtagtttgccattctccaattggacgacctcttacgggaatgat
ctaccggagactagtctcatcgaagggtttgacggccgtgtccgtgacaatataacaaag
cgttggcacccacttcacaccgctcaatacctattcacgaagtctttcatgcctcatttt
atcctgcggtataatggggataatattgacatggttaatcaagttgaaagccgctgcccc
ttccttgatcatcatctgaccgaatatgttaacaatgtgccaccgagtctcaagctaaag
tacctcccggaagaaaagtccttccgtgaaaagtacattcttcgagaagctgtgaagcct
tacgtcaccgatgagatttacaacatcagcaagaaagcctacatgggtccgaggaaattc
tggcctggcggaccgttgcacaggaaaatcaagcagttggtcacaaaggagaacgttgaa
agcctgggatttgtggactggaatgctacgcaagaagctgttgaaaaagctttcaccaag
caggatccaatgggactccgccgcacgattacggttgcccagttcattgttctagggaag
cgcttcggagtcaagccagctggtgccctgccaaactga

DBGET integrated database retrieval system