KEGG   Penicillium chrysogenum: Pc21g12790Help
Entry
Pc21g12790        CDS       T01091                                 

Definition
Pc21g12790
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pcs  Penicillium chrysogenum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Pc21g12790
   00052 Galactose metabolism
    Pc21g12790
   00500 Starch and sucrose metabolism
    Pc21g12790
   00520 Amino sugar and nucleotide sugar metabolism
    Pc21g12790
Enzymes [BR:pcs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Pc21g12790
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 518 aa AA seqDB search
MTSKALPTHLRAPAESEGFGGKHHGKSQSHMAFENASTSVAASQMRNALNALGDTVTDPN
EKKRFEAEMDNFFALFRRFLNDKAKGNAVNWDKIAPPQPSQVVGYDDLGADASVEFLNKL
AVVKLNGGLGTSMGCVGPKSVIEVREGMSFLDLSVRQIEHLNRSFNVNVPFVLMNSFNTD
QDTQSIIKKYEGHNVDIITFNQSRYPRIIKDSLLPAPKSFDSPLQDWYPPGHGDVFESLY
NSGTLDKLIERGIEYIFLSNADNLGAVVDLRILQHMVDSQAEYIMELTDKTKADVKGGTI
IDSDGKVRLLEIAQVPKEHVNEFKSIKKFKYFNTNNIWLNVQAIKRVVEENELEMEIIPN
EKSIPADKKGEADQAIYQLETAVGAAIRHFKNAHGVNVPRRRFLPVKTCSDLMVVKSDLY
RLEHGQLVMDPNRFGGVPVIKLGTDFKKVSDFQKRIASIPRIVELDHLTVTGPVNLGRNV
TLKGTVIIVASEGSTIDIPPGSVLENCVVQGSLRILEH
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgacctccaaggctctacccactcaccttcgagcccctgctgagagcgagggctttggt
ggaaagcaccatggcaagtcgcaatcgcacatggcattcgagaatgcatccactagcgtc
gccgcctcacaaatgcgcaatgccctgaacgccctcggcgacaccgtcaccgaccccaac
gagaagaagcgtttcgaggccgagatggacaacttcttcgccctgttccgccgcttcctg
aacgacaaggccaagggcaacgccgtcaactgggataagatcgccccgccccagccttcc
caggttgttggatacgatgacctcggtgccgacgcctccgtcgagttcctgaacaagctg
gccgttgtcaagctgaacggtggtctcggtacctccatgggttgcgtgggtcccaagtcc
gtcattgaggtccgtgagggcatgtccttcctcgatctctccgtgcgccagatcgagcac
ctcaaccgcagcttcaacgtcaacgtgcccttcgtcctcatgaactccttcaacaccgac
caggacacccagtccattatcaagaagtacgagggccacaacgtcgacatcatcaccttc
aaccagtcgcgctacccccgcatcatcaaggactcgctcctgcccgcccccaagagcttc
gactctcccctccaggactggtacccccccggacacggtgacgttttcgagtccctgtac
aactccggtactctcgacaagctgattgaacgtggcatcgagtacatcttcctgtccaac
gccgacaacctcggcgccgtggtcgatctccgcatcctgcagcacatggttgactcccag
gccgagtacatcatggagttgactgacaagaccaaggctgacgtcaagggaggtaccatt
attgactccgacggcaaggtccgtctgctcgagattgcccaggtccccaaggagcacgtc
aacgagttcaagtccatcaagaagttcaagtacttcaacaccaacaacatctggctgaac
gtccaggccatcaagcgtgtcgttgaggagaacgagttggagatggagatcatccctaac
gagaagtccattcccgccgataagaagggtgaggccgaccaggctatctaccagctggag
accgccgtcggtgcggccatccgccacttcaagaacgcccacggtgtcaacgtgccccgt
cgccgcttcttgcccgtcaagacctgctccgacctgatggtcgtcaagtctgacctgtac
cgtctcgagcacggccagcttgtcatggaccccaaccgcttcggtggtgtccccgtcatc
aagctcggtaccgacttcaagaaggtctccgacttccagaagcgcattgccagtattccc
cgcatcgtcgagctggaccacctcactgttaccggacctgttaacctcggccgcaacgtc
accctcaagggaaccgttatcattgttgcctccgagggcagcaccattgacattccccct
ggatccgtgcttgagaactgtgttgtgcagggtagcctgagaatcctcgagcactag

DBGET integrated database retrieval system