KEGG   Penicillium chrysogenum: Pc21g13280Help
Entry
Pc21g13280        CDS       T01091                                 

Definition
Pc21g13280
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
pcs  Penicillium chrysogenum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 707 aa AA seqDB search
MATFPLNVPPELLQELSKYTTPTGVADYAALALIGGIGATFLSRGRLWDKPDPLHHLWFE
RPQLKNGGQAGSANKETRNIAQKLEETGKNIVVFWGSQSGTAEGFAHRLAREISIRWGQE
AMTADLSDYDPITISEIPNAKLAIFVVSTYGEGDPSDNTAEFWSWISKASEVSLSNLRYA
AFGLGNTNYKFYNRVVDVIVEGLEKFGAQALMPVGKANDAEGATEEDFMSWKEDLFVVFK
DKLGMQEAEARYIPSLKVEEDESLEPIDLHHGEPNNRAEAPKAAAQSSAVRTLSISDSRE
LFTSSTRHCLHMDVDLTSQPELSYKTGDHLAIWPGNPDVEVERLLDVLGISSRRDIPLGI
TALDSATKVPIPTPTSSIAIFRYYLEICAPVNRDNVRDLAQFAPTPEAKSYLLALGKDKD
AYASFIGRTHINLGRLLQLACPDRPWNNLPLSYVVETLPHIRPRFYSISSSSIVSPRKPS
ITAIVSTTPLPENPNELIHGVTSNYLLAISQQARSQSHPSGITYHLNGPGDALQGGKVFA
HIRRSKFKLPALGKTPLVMVAAGTGIAPFRAFLSERCQLLKIGKEVGPMILFFGCRNPNE
DYIYREELEEMQAVLGDRLRIVTAFSRLEGTPRQYVQDRVGEFGKDVIDVVEEGGNIYVC
GRAGMAREVEKVVGRTMKEAKGWSDDEVNGWSKTIKKKNKWQEDVWG
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccttcccactcaatgtcccaccagaactactgcaagagctctcaaaatacacc
acaccaacaggagtggccgattatgccgccctagccctgataggaggaattggagccaca
ttcctttccagaggacgactttgggacaagccagacccattgcaccatctctggttcgaa
cggccccagttaaagaatggtggacaagctggttcagccaacaaggagacacgcaacatc
gcacaaaagctggaagagacgggcaagaatatcgtggtattctggggatcgcagtccggc
acggcagagggttttgcccaccgtcttgctagggagatctccatccgctggggccaggaa
gccatgactgccgacctctcggactatgacccgatcacaattagtgaaatccctaacgcc
aagttggctatcttcgttgtttccacctacggcgaaggagaccccagcgataatacagcg
gaattttggagctggatctctaaagccagtgaggtgtcgctctccaacttgcgatatgct
gccttcggtttgggaaataccaactacaagttctacaaccgagttgtcgatgttattgtt
gaagggctggagaaattcggtgcccaggctcttatgcctgttggaaaggcaaatgatgca
gagggggcaaccgaggaagacttcatgtcatggaaagaggatcttttcgtggtcttcaaa
gataagttgggaatgcaagaggccgaggccagatatatcccgagcctgaaggttgaagaa
gacgagtctcttgagccaatcgacctgcatcacggtgaacccaacaaccgggctgaagcc
ccaaaggcagcggctcaatcctccgctgtccgtactttgagcatttcagactccagggag
ctcttcacgtcgtctacccggcactgccttcacatggacgtggacctgaccagtcaacca
gagctgagctataagaccggagaccaccttgccatctggcccggaaatcccgatgttgaa
gtcgaacgcctacttgatgtcctcggaatctcctcgcgccgcgatatcccacttggtatc
acggcactcgactcagcaaccaaagtcccgatcccaaccccgaccagctccatcgccatt
ttccgttactacctcgagatctgtgcacccgtcaaccgcgataacgttcgcgacctggca
caattcgcacccaccccagaagcaaagtcctatcttctcgcgcttggcaaagacaaggat
gcatacgccagctttatcggtcgcacacacatcaacctcggccgactgttgcagctagca
tgccctgaccggccttggaataacctcccactctcatacgtcgtcgaaacactaccacac
atccgaccgcgattctattccatctcatcaagcagcatagtctcgccccgcaaaccatcc
atcacagcaatcgtatcaacaacccctctcccagaaaaccccaacgagctcatccacggt
gtgacatccaattacctcctcgccatctcccaacaagcgcgctcccagtcccatcccagt
ggaatcacctaccacctcaacggccccggtgacgcactccaaggcgggaaagtctttgcc
catatccgccgaagcaaattcaaactcccggctctgggcaagacgcctttggtcatggtc
gcagcagggacgggtatcgcgcccttccgggcattcttatctgagcgttgtcaattgctc
aagatcggtaaggaagttggaccgatgattctcttctttggatgtcggaaccccaatgag
gattacatctaccgcgaggaattggaagaaatgcaagctgtgctgggtgatcggttgcgt
attgtcactgccttttcgcgattggaggggacccctcgtcagtatgtgcaggaccgggtt
ggcgagttcgggaaggatgtgattgacgttgttgaggagggtggtaatatctatgtctgt
ggaagagctggtatggctcgtgaagttgagaaggttgttggacggacgatgaaagaggct
aagggctggagtgatgatgaggtgaatggttggagtaagacgattaagaagaagaataag
tggcaggaggatgtttgggggtag

DBGET integrated database retrieval system