KEGG   Penicillium chrysogenum: Pc21g13600Help
Entry
Pc21g13600        CDS       T01091                                 

Definition
Pc21g13600
Orthology
K03259  
translation initiation factor 4E
Organism
pcs  Penicillium chrysogenum
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Pc21g13600
Translation factors [BR:pcs03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Pc21g13600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 238 aa AA seqDB search
MAAVAENGTPAVADENSAPVTETQTGDAVTVFHNPDDFNVKHPLMHEWTLWFTKPPSGKG
DNWNDLLKEVVTFSSVEEFWGIYNNITPTSELGLKADYHLFKKGVRPEWEDPQNKHGGKW
SYQFKDKRSVPIDELWLHAQLAAIGETLENDDDNEVMGVVVNVRKGFYRVGLWTRTVGKS
IQGDKHTRTQAQGKEILEAIGQRFKDVLRLNLADVVEFSGHTDSAHSGSTRAKAKYTV
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgtcgcagaaaatggtactccggctgtggccgacgagaactccgctcctgtc
accgagactcagactggtgatgccgttactgtcttccacaaccccgatgacttcaacgtg
aagcaccctcttatgcacgaatggactctgtggttcaccaagccccccagtggcaagggc
gacaactggaacgatctgctcaaggaggtggttaccttcagctccgtcgaagaattctgg
ggcatctataacaacatcacgccgacctccgaacttggcctcaaggccgactaccacctc
ttcaagaagggcgtacggcccgagtgggaggacccccaaaacaagcacggtggaaagtgg
tcgtaccaattcaaggacaagcgctccgttcctatcgacgaactctggctgcacgcgcag
ctggccgcgatcggcgagaccctcgagaacgacgatgacaacgaagtgatgggagtggtt
gtgaatgtgcgcaagggcttctaccgtgttggtctatggacacgcacagtcggcaagagc
atccaaggcgataagcacacccgcacacaggctcagggcaaggagatcctcgaggcaatt
ggccagcgcttcaaggacgtgctgcgactcaacttggcggatgtggtggagttctccggc
cacaccgacagtgcacacagcggcagcacgcgcgcaaaggccaagtacaccgtttaa

DBGET integrated database retrieval system