KEGG   Penicillium chrysogenum: Pc21g14410Help
Entry
Pc21g14410        CDS       T01091                                 

Definition
Pc21g14410
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pcs  Penicillium chrysogenum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pc21g14410
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Pc21g14410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 574 aa AA seqDB search
MQILLSAIVALGIAQTATAAPTGAVCTGTFSAISAADFVSNLHPGWNLGNTLDAIPDEGS
WNNVPVVASTFDTVKDAGFKSVRLPVTWADHFIGSSPDWTVDPTWLDRVSDVVDMIVARG
LYAIVDVHHDSWNWADVTQSGANLTMIEEKFYSLWYQIGTKLACKSNLVAFEPINEPPCN
TAADGTKINKLNKIFLQAINDAGGFNSQRVVTLVGGAQDSIKTADWFVAPSGFSNPYAIQ
FHYYSPYDFIFSAWGKTIWGSDSDKSAVQSDFQRLRNTFPDVPLLLGEYDASPTNTEPAA
RWKYVDFLTKTAASLDISCVLWDNGLDHLDRTTGVWRDTNSLSIITKSTESTANSLPDST
EDASATTQSSSAYIFHQYGTDVTEQTLPFIFNGNKLSSISDSTGSTLSGTDYSVSGANII
FTASYLSKHLSSTTAPGVIATLTLKFSGGDTSPVIQIVQWKAPTLSSTSAVASSVSGSDL
SIPITWGGLPTVAAVKALTTSGKYLVDDWTVSLGPIQQARATYSSQYNWDDSHVILTSSA
ISSVISAGESTVFTFEFFPRDNGVANAVNFTLTV
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgcagattctgctttctgccatcgtggctctcgggatagcccagacagctactgctgcc
ccaacaggggctgtgtgcactggaacatttagcgcaatctcagccgccgattttgtgtct
aatctacatcccggttggaatctaggaaatacacttgatgctatccccgatgagggatct
tggaataatgtaccagttgtggcgtcgacatttgataccgtgaaggatgccggcttcaag
agtgttcgactcccagttacctgggctgatcactttatcggaagttcacctgattggaca
gttgacccaacatggttggaccgagtctccgatgtggtcgatatgattgtggcccgtgga
ctgtacgctatcgttgatgtgcatcatgattcatggaattgggctgatgttacccaatcc
ggagccaatcttaccatgattgaagagaaattctacagcctctggtatcaaattgggacc
aagttggcctgtaaatcgaacctcgttgcctttgaacccatcaatgagcctccgtgcaat
actgcggccgacggtaccaagatcaacaagctgaacaagatcttcctccaggcgattaat
gatgccggtgggttcaactcgcaaagagtcgttactctagttggaggtgctcaggatagc
atcaagactgcagactggtttgttgcaccttctgggttttcaaacccatatgctattcag
ttccactactacagtccctacgacttcattttcagcgcttggggaaagactatttggggc
tctgacagtgacaagtctgctgtacagtctgacttccagcggctgcgcaacactttccct
gatgtacctctccttttgggtgaatatgatgcttcacccaccaacaccgagcccgctgct
cgatggaagtacgttgacttcttgaccaagactgcagccagtcttgacatctcctgtgtg
ctgtgggataatggactggaccacttggatcgaaccaccggggtctggcgtgacactaac
tcactctcgatcatcacaaaatccaccgagtctactgcaaatagtctgccagacagtaca
gaggacgcttctgcaaccactcagtcatcgtcggcttatattttccatcagtatggaaca
gacgtgacggaacagactcttccatttatcttcaacggtaacaagctctcgtcgatcagt
gactctactggctctaccttgtccggaacagactattctgtctcgggtgcgaatataatc
ttcacggcctcatatttatccaagcatctttcgtccacgacagcaccgggtgtcatcgcc
actctaaccctgaagttctcggggggtgacacgtcccctgttatccaaattgtacaatgg
aaggctccaactctgtcatctacgtcggcagtggcctcgtctgtctccggctctgaccta
tcgatcccaatcacctggggtggactaccaactgtcgctgcagtaaaggctttgaccaca
agtggaaaatacctggtcgatgactggacagtatcgctgggtcctatccaacaagccaga
gctacctatagtagccagtataactgggacgactcccatgtaatcctcacttcatctgct
attagctccgtcatctctgctggcgaatcgactgtattcaccttcgagtttttcccgcgg
gataatggtgttgcgaatgctgtcaactttaccttgaccgtctga

DBGET integrated database retrieval system