KEGG   Penicillium chrysogenum: Pc21g14820Help
Entry
Pc21g14820        CDS       T01091                                 

Definition
Pc21g14820
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
pcs  Penicillium chrysogenum
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Pc21g14820
  Lipid metabolism
   00561 Glycerolipid metabolism
    Pc21g14820
   00600 Sphingolipid metabolism
    Pc21g14820
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    Pc21g14820
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Pc21g14820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 436 aa AA seqDB search
MLGPLTLAVTLPFLPAANALVRDNDVGKLPALGWNTWNAFGCDIDSTKIITAANEVINRG
LKDLGYEYINIDDCWSVKNTRDKSTNRMIPDPTKFPDGISGVAKEVHDLGLKIGIYSSAG
EETCAHYPASLGYEAVDAQSFAEWGIDYLKYDNCGVPSNWTDEYTYCVPDGDGPYPDGTC
PDLTNPAPEGYDWKTSNTYKRYAAMRDALLDVERTIFYSLCGWGQANVNSWGMEVGNSWR
MSGDITVDWARIAQIANENSFYMDHVNFWGRADPDMLEVGNGDLTIEENRAHFALWAVMK
SPLIIGTALDSIDDAHLAILKNKYLLDFNQDPVIGTPARPYKWGYNPDRTFDPVHPAEYW
SGASSTLDGTVVLMLNSENVTSTRTATWREIPELKSHDAYQVVDAWTGKDLGCVKNKYKA
SLKSHDAAVLVVKEKC
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgctaggaccattgactctcgccgttacattgcctttcctcccagcagcaaatgctctg
gtcagggataatgatgttggcaaattgcctgctctaggctggaatacctggaatgcattc
gggtgtgatatcgattctaccaaaatcatcaccgcggccaatgaggtcatcaatcgtgga
ctgaaggatctaggatatgaatatatcaatatcgatgactgctggagcgtcaagaacacc
cgcgacaagagtaccaatcgcatgattcctgatccaaccaagttccccgatggtatttct
ggcgttgcaaaggaagtccatgatttgggactgaaaatcggaatctacagcagtgctggt
gaggagacctgcgctcactatcccgctagtctgggatacgaggcagtcgatgcgcagtct
tttgctgagtggggtattgactacctcaaatatgacaattgtggtgttcccagtaactgg
acagatgaatatacttactgtgtccctgacggcgacggcccttacccggatggcacctgt
cctgatctcaccaatcccgctcccgagggatatgactggaaaacgtccaacacatacaag
cggtatgctgcaatgcgcgatgcattgctcgacgttgaacggaccatcttctattcactc
tgtggctggggtcaggctaacgtgaattcctggggcatggaagtcggaaactcatggcgc
atgtctggcgacattactgtggattgggcccgtattgcgcaaattgccaatgagaacagc
ttctacatggaccacgtcaacttctggggtcgtgctgacccagacatgttggaggttggt
aatggtgatcttaccattgaggaaaacagggcgcactttgcactctgggccgtcatgaag
tcccctctgataattggcacggcgctcgattctatcgacgatgcccacttggccatcctg
aagaacaagtatcttcttgacttcaatcaagatcctgttattggaactcctgcccgtcct
tataagtggggatacaaccccgacaggactttcgacccggttcaccctgctgaatactgg
tccggtgcatcatccactttggacggcactgtggtgcttatgctgaactctgagaatgtc
acttctactcgtactgcgacatggcgcgagatcccggagctgaagagtcatgatgcgtac
caggttgttgatgcctggactggcaaggatctgggctgtgtgaagaacaagtacaaggcc
tccttgaagagtcatgatgcggctgtgttagtggtcaaggaaaaatgctag

DBGET integrated database retrieval system