KEGG   Penicillium chrysogenum: Pc21g15560Help
Entry
Pc21g15560        CDS       T01091                                 

Definition
Pc21g15560
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pcs  Penicillium chrysogenum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Pc21g15560
Enzymes [BR:pcs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Pc21g15560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 380 aa AA seqDB search
MPPLIRVIGSLNADMVSVTPRFPNPGETITSSSYFTSAGGKGANQAVACGRMSRAKPTGT
TNSTSDVNVDMMGAVGALDGHFSALLKPTLERSGVDPSRVKVIENAYTGVAVIIVDSSAG
GENRILFSPGANYDGMQPTPEVLGMALAAPVPDVIVMQGEIPVDTVIGILREVASYKAKA
RAAGKCGIECGPDVMLNPAPAPPGGLPEDVYAAVDHLILNETEAELMTPPVDQLLRTAPD
AEGLDSKEKVARYFHKLGVTYILITFGANGVWYSAAASGSSGPSDGVHRFTNDIPAAPVS
RVLDTTAAGDTFVGAYAVRVARWREKRRAEGKAGQDIADDEKTYRYKTVMDEAMRLAARA
SARTVERQGAMDSIPFEDEI
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgccacctcttatccgagttattggatccctcaatgcggacatggtctcggtcacgccc
cgatttccaaacccaggcgagacaatcacctcctcatcctacttcaccagcgcgggcggc
aagggcgcaaaccaagccgtcgcatgtggacgcatgtcccgagccaagccaaccggcacc
acgaactccacaagcgacgtcaatgtcgatatgatgggcgcagtaggggctctggacggt
cacttttccgccttgcttaaaccgacccttgagagatctggtgtcgacccgtcgcgagtc
aaagtcatcgagaacgcatacacgggtgtcgcggtgataatcgtggactcgtcagctggt
ggcgagaaccgcattctgttctcgcccggtgcaaattacgacggcatgcagcctactccg
gaggtgctaggcatggcgctagcagcgcctgttcccgatgttatcgtcatgcagggagag
atcccggtcgacactgttatcgggatactacgtgaggttgcttcttacaaggccaaggct
cgcgccgctgggaaatgcggcattgagtgcggcccggatgttatgcttaacccggcacct
gcgccgcctggtggcctgcccgaggatgtgtacgctgctgtcgaccatttgatcctcaat
gagacagaggctgagctgatgactccgcctgtggatcaactgcttcgcacggctccggac
gcagagggcttggatagcaaggagaaggtcgctcgatatttccacaaattgggtgtcacc
tacattcttatcacgttcggggcgaacggcgtttggtacagtgccgcagctagcggctcg
tctggaccaagtgatggagtacaccgcttcaccaatgatatcccagccgcccctgtttct
cgggtcctggatactactgccgcgggtgatacatttgttggggcctatgccgtcagggtg
gcgcggtggcgcgagaaacgtcgtgcggagggcaaggctggacaggatattgcggatgat
gagaagacatacaggtacaagactgtcatggacgaggcgatgcgtttggctgcacgcgcc
tcggctcggactgtggaacgtcagggcgccatggatagcattccctttgaggatgagatc
taa

DBGET integrated database retrieval system