KEGG   Penicillium chrysogenum: Pc21g16180Help
Entry
Pc21g16180        CDS       T01091                                 

Definition
Pc21g16180
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
pcs  Penicillium chrysogenum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 1109 aa AA seqDB search
MENLAENDMLVDDYDQYPAEKTDVVVVSRSGSDEPESAPTADDHAAMMAKVLPQNPDLET
LDEVYNSWHLSEWRKMDRKSHGPIFRCGGSPWRILFFPYGNQTEYASFYLEHAWEDGPPE
NWYACVQFGLVLSNVNDPSIYTHHVATHRFTAEEGDWGFTRFADLKGLFSHAWEGKSVPL
VQDDEAIITAYVRVVKDPTGVLWHSFQNYDSKKETGMVGLRNQGATCYLNSLLQSLYFTN
AFRKAVYQIPTDQEATRENSAWALQRLFYNLQTNDVAVSTTELTASFGWQSSQIFEQQDV
QELSRKLMERLEHKMKGTVAEKVLPDLFVGKTKTYISCINVDYESSRVEDFWDIQLNVRG
NKSLDDSFRDYIQVETLEGENKYEAGQPYGLQDAKKGVIFESFPPVLHLHLKRFEYDLNL
DMMAKVNDYHSFPMEFDAAPYLSESADKSESWVYQLHGVLVHSGNLDAGHYYAFLKPTKD
GHWYRFDDDRVNRATDKEVLDENYGDSQQRTNGTGGRSAMRTNNAYMLVYIRKTRQDNVL
LPVAKDDVPSHIEKRMTEDRAEMLRRKKEREEAHLYMNIGVLNEDSFRSHHGFDLTSNDL
PADDPALPTQYKVLRAKKVSEFAQEIAEERGLKPEAIRFWAMVNRQNKTTRPDQVIRDQE
MTLEEAYNKCGTKGQLFRLWVEVAPTGADGQPTPWPDNDSILVFLKNFDIAAQTLTGVCS
VYVQKTQKVSELAPIILSKMDWPAGTEFMLFEEIKHTMIDVMKPKQTFQQSEIQDGDIIT
FQRAIKESELPASALYTDARQFYDYLLNRMEVQFAPIKTNEGETFYLTLSRKMTYDQFAK
KVGEHLQVDETHLRFAPVMASTGKAKPFLKRNVNQNLSQILNGQYGAYGYTMHRADALYY
EILDMSLSDYESKKCFKVTWLPDGITKEEIVEVLVSRSGTVADLLAALQQKLELGDEPIR
VAETHSGKVYKELREDQNVATINDYATLYAEKIPSEELKLDTEDRVISVFSFDREPNRAH
GIPFKFVVKPGELFAETKKRLSVRTQIKGKNFEKIKFAVVPRTSFSNAKYLEDGDILSDV
AAGADDFLGLDHPNKSRSFWGKSDGFSIR
NT seq 3330 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacctcgcggagaacgacatgcttgtcgatgattatgatcaataccctgccgaa
aagaccgatgtcgtcgtcgtttcccggtcgggatccgacgagcctgagtccgcaccgacc
gcagatgaccacgcggcgatgatggcaaaggtcctccctcagaacccggaccttgaaacc
ctagacgaggtctacaactcatggcacttgtcagaatggcggaaaatggatcgcaagtca
cacggacccatcttccgatgcggtggttccccctggcgcatcctctttttcccctacggc
aaccagaccgaatacgcctcgttttacctcgaacatgcgtgggaggacggacctccggag
aactggtacgcttgtgtgcagttcgggctggtgctgtcaaatgtgaacgatccttctatt
tacacacaccacgttgcgacgcaccgtttcaccgccgaggaaggggactggggtttcact
cgatttgccgacctcaaaggtctgtttagccatgcgtgggaagggaaatcagtcccgttg
gtgcaggatgatgaggcgattatcacggcctatgttcgtgtggtgaaagatcccaccgga
gtcttgtggcacagtttccaaaattacgactcgaaaaaggagactggaatggtgggattg
aggaaccagggagctacatgctacttgaactcacttttgcagtcgctttatttcacaaat
gcttttcgcaaggccgtgtaccaaataccgactgaccaggaagctacgcgtgagaacagc
gcgtgggccctccagagactattctacaacctgcagaccaacgacgttgctgtttccaca
actgagctcaccgcatcttttggctggcaatccagccagatttttgaacagcaagatgta
caggagctctcacgaaagctcatggaaagattggagcacaagatgaaaggtacagttgca
gaaaaagtcctgcctgatctgttcgtcggaaaaacaaaaacgtatatttcttgcatcaat
gtggattacgagtcttctcgcgtggaagacttctgggatattcaactcaatgttcgaggc
aacaagagcttagatgacagcttcagggattacattcaggttgagacgttggagggggag
aacaagtatgaagctgggcagccatacggtctgcaagacgcaaagaagggcgtcattttc
gagagcttccctcccgttctgcatcttcaccttaaacgtttcgagtacgacctcaacctc
gacatgatggccaaggtcaatgattatcactccttccctatggagttcgatgcggcccct
tatctttctgagagcgccgacaagtcggagtcctgggtttaccaattgcacggcgttctc
gtccacagcggtaacctcgatgccggacattactatgccttcctcaagcccaccaaggat
ggacactggtaccgctttgatgatgaccgagtcaaccgagctactgacaaggaagtcctg
gatgagaactacggagactcccagcagcgcacgaacggcactggaggacgatccgctatg
cgcacaaacaacgcctacatgttggtttacatccggaagacgaggcaggataatgtatta
ttaccggtcgcaaaggatgacgtgccctctcacattgagaagcgtatgactgaggaccgg
gcggagatgctgcgtcggaagaaggagagagaggaagctcacctttacatgaatattggc
gtgcttaacgaagattcattccgaagccaccacggcttcgatctgactagcaatgaccta
cccgcggacgatccagcccttcccacgcaatacaaggttctccgggcaaagaaagtcagc
gaatttgcacaggaaatcgccgaagaacgaggtctcaaaccagaagccattcgattctgg
gccatggtcaaccgtcagaacaagacaacccgacccgatcaggtgatccgcgatcaggaa
atgactcttgaggaggcttacaacaaatgtggcactaaaggccagctgttccgcttgtgg
gtggaagtggcaccgaccggcgcagacggacaacccacgccgtggcccgataatgactcg
attctcgttttcctcaaaaactttgacattgccgcccagaccttgactggtgtctgctct
gtctacgttcagaagacccagaaggtgagcgagctggccccgataattctttccaagatg
gattggccggccggcacggagttcatgctctttgaagagatcaaacataccatgatcgac
gtcatgaaacctaagcagactttccagcaatctgaaattcaggacggcgacatcattacc
ttccagcgcgcaatcaaagagtccgaactgccagcatcagcactttacacggacgctcgg
caattctacgattatcttttgaaccgcatggaagttcaattcgccccgatcaagaccaat
gagggggagactttctacctgactctcagccgcaagatgacctatgaccagttcgccaag
aaggttggtgagcacctccaggtggatgagactcatcttcgattcgcgcccgtgatggcc
agtactggcaaggccaagcctttcctgaagcgaaacgtcaatcagaacctctcacaaatc
cttaacggtcaatatggtgcctatgggtacaccatgcaccgggcagacgcattgtactac
gagatactggacatgagtttgagtgactatgagagtaagaagtgctttaaagtcacatgg
ctgcccgacggtatcaccaaagaggaaattgttgaggtcttggtttcccgtagcggcacc
gtggcagatctgctggctgcgttgcaacagaagctggaacttggcgatgagccgatccgg
gtcgccgaaacacacagtggaaaggtctataaagagctccgggaagatcaaaacgtggct
accattaacgactacgccacactctacgccgaaaagatcccatccgaagaattgaagttg
gacaccgaggatcgcgtcattagcgtgttcagcttcgaccgcgaacccaacagggctcac
ggaatccctttcaagttcgttgtgaagcccggagaacttttcgccgagacaaagaaacgg
ctgtctgtccgcacacagatcaagggcaagaacttcgagaagatcaagttcgccgtggtc
ccccggacatctttctctaacgccaagtatctcgaagatggtgatatcttgtcagatgta
gcggctggtgccgacgacttcctgggtcttgatcatcccaacaagagccggagcttctgg
ggcaagagtgatggattctccattcgttaa

DBGET integrated database retrieval system