KEGG   Penicillium rubens: Pc21g16300Help
Entry
Pc21g16300        CDS       T01091                                 

Definition
(RefSeq) Pc21g16300
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
pcs  Penicillium rubens
Pathway
pcs00790  Folate biosynthesis
pcs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pc21g16300
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Pc21g16300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-GeneID: 8309849
NCBI-ProteinID: XP_002568637
UniProt: B6HKY8
Position
1
AA seq 341 aa AA seqDB search
MGSGSPTSPRASAIPSHMLNGSSPLQRSTSSRDSRERESLNTSIRSSFEPRIPLEFESPN
TETKTETEGDNETGATPAQSVSSASVPIRSVAPVRPSLNDPPRDPRDEAAPLTPSTSLSR
PESPYTLNPPIDFDGLSWPCPGTRQRKESTPEETEQRLEKMSGAIRTILECIGEDPEREG
LRETPLRYAKAMLYFTKGYEENVRDLVNNAVFHEDHDELVIVKDIDVFSMCEHHMVPFTG
KMHIGYIPDRRVLGLSKLARLAEMFSRRLQVQERLTKQVALAISEVLQPRGVGVVMESSH
LCMVMRGVQKVSSTTTTSCMLGCMRSSAKTREEFLTLLNRR
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgggttccggttcgcctacaagccccagggcctcagccattccgtcccacatgctgaac
ggtagctccccgctgcaacggtcaacaagcagccgtgattctcgtgagcgtgaaagtctc
aatacgtccattcgttcctcttttgagccccgcatcccccttgaattcgaatcccccaac
actgagaccaagaccgagaccgagggcgataatgagactggagccacccccgctcagtct
gtatccagtgcttccgtgccaattcgcagcgtggcgccagtgcgtcctagcttgaatgac
cctccccgcgatccccgggatgaggccgccccattgacgccttcgacctctctcagccga
cctgaaagtccctacacgttgaaccctcccatcgactttgatggtctcagctggccttgc
cccggaactagacagcgaaaggagtcgacacccgaggagacagaacaacggcttgagaag
atgtcgggagctatccgcacaatcttggaatgcatcggcgaggatccggaaagagaagga
cttcgcgagacccccttgaggtatgccaaagccatgctctatttcactaagggctacgag
gagaatgttcgggacttggtcaacaatgctgtcttccacgaggaccacgatgagttggtc
atcgtcaaggatattgacgtcttctcgatgtgcgaacaccacatggtaccgttcactgga
aaaatgcatatcggatacatccctgaccgccgcgtccttggtttgtcaaaactggctcgc
ctggcagagatgttctctcgcagactccaggtccaggagcgtcttaccaagcaagtcgcg
ttagcaatttcagaggtcctccagccacgtggcgtcggtgtcgtcatggaatcttctcac
ctttgcatggttatgcgcggcgtgcagaaggttagcagcaccaccactaccagctgtatg
ttgggatgcatgcgttccagcgccaagactcgtgaagagttcttgactctgttgaaccgg
agataa

DBGET integrated database retrieval system