KEGG   Penicillium chrysogenum: Pc21g16300Help
Entry
Pc21g16300        CDS       T01091                                 

Definition
Pc21g16300
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pcs  Penicillium chrysogenum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pcs00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 341 aa AA seqDB search
MGSGSPTSPRASAIPSHMLNGSSPLQRSTSSRDSRERESLNTSIRSSFEPRIPLEFESPN
TETKTETEGDNETGATPAQSVSSASVPIRSVAPVRPSLNDPPRDPRDEAAPLTPSTSLSR
PESPYTLNPPIDFDGLSWPCPGTRQRKESTPEETEQRLEKMSGAIRTILECIGEDPEREG
LRETPLRYAKAMLYFTKGYEENVRDLVNNAVFHEDHDELVIVKDIDVFSMCEHHMVPFTG
KMHIGYIPDRRVLGLSKLARLAEMFSRRLQVQERLTKQVALAISEVLQPRGVGVVMESSH
LCMVMRGVQKVSSTTTTSCMLGCMRSSAKTREEFLTLLNRR
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgggttccggttcgcctacaagccccagggcctcagccattccgtcccacatgctgaac
ggtagctccccgctgcaacggtcaacaagcagccgtgattctcgtgagcgtgaaagtctc
aatacgtccattcgttcctcttttgagccccgcatcccccttgaattcgaatcccccaac
actgagaccaagaccgagaccgagggcgataatgagactggagccacccccgctcagtct
gtatccagtgcttccgtgccaattcgcagcgtggcgccagtgcgtcctagcttgaatgac
cctccccgcgatccccgggatgaggccgccccattgacgccttcgacctctctcagccga
cctgaaagtccctacacgttgaaccctcccatcgactttgatggtctcagctggccttgc
cccggaactagacagcgaaaggagtcgacacccgaggagacagaacaacggcttgagaag
atgtcgggagctatccgcacaatcttggaatgcatcggcgaggatccggaaagagaagga
cttcgcgagacccccttgaggtatgccaaagccatgctctatttcactaagggctacgag
gagaatgttcgggacttggtcaacaatgctgtcttccacgaggaccacgatgagttggtc
atcgtcaaggatattgacgtcttctcgatgtgcgaacaccacatggtaccgttcactgga
aaaatgcatatcggatacatccctgaccgccgcgtccttggtttgtcaaaactggctcgc
ctggcagagatgttctctcgcagactccaggtccaggagcgtcttaccaagcaagtcgcg
ttagcaatttcagaggtcctccagccacgtggcgtcggtgtcgtcatggaatcttctcac
ctttgcatggttatgcgcggcgtgcagaaggttagcagcaccaccactaccagctgtatg
ttgggatgcatgcgttccagcgccaagactcgtgaagagttcttgactctgttgaaccgg
agataa

DBGET integrated database retrieval system