KEGG   Penicillium chrysogenum: Pc21g16610Help
Entry
Pc21g16610        CDS       T01091                                 

Definition
Pc21g16610
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
pcs  Penicillium chrysogenum
Brite
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Pc21g16610
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     Pc21g16610
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     Pc21g16610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 549 aa AA seqDB search
MATPVPEEAKAEETAQESRVLIIMTGGTICMQPSPAGFIPARGFQEKCMARVPSFNDGSD
SATMDVVVNAVREVKEHPSLRTPMTAYGRQVRYTVFEFEELLDSSSIDAKGWTQIAEAIE
RNYTLFDGFVVLHGTDSLAYSCSALSFMLQNLGKPVVLTGSQAPMLELQNDATDNLLGSL
VVAGHFMIPEVCLYFNNRLFRGNRTTKVAASDFAAFDAPNCAPLAVTTSMRTNVNWDMVH
RPTSLAPFSIQTNLDTTHVACLRIFPGIKPEMVDAVLKLDGLRGLILETFGAGNAPSGQD
NAMINVLASAIQRGIVIVNITQCLTGSVSPVYATGMSLSRAGVVAGLDMTTEGALTKLAY
LLALPESTPESIARRMAVSLRGELTESSLPIFRHPDGALPERIQTLTSMGYAIAHGDLEK
VQAITKTEHHWLLNDADYSGNTPIHLAATSPSIEILHFLLSQGGSVHLRNRAGRTPLFLA
ANAGLSEHTLLLRKSGAHLHSDERPAAELLARHRPFVWGMAGVGPKEISQREMEEDVDKN
RVIPGSAPS
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggccactccagtgccggaagaagccaaagccgaggaaacggcacaagaatcgcgcgtt
ctaatcatcatgacaggcggcacaatctgcatgcagccctcaccagccggcttcatccca
gcgcgcgggttccaagaaaaatgcatggcgcgggtgccaagcttcaacgacggctcggac
agcgcaacaatggacgtggttgtcaacgccgtgcgcgaagttaaagaacatccaagcctg
cgcacaccgatgacagcctacgggcgacaggtacggtatacagttttcgagtttgaagaa
ctgctcgacagcagctcgatcgacgcaaagggctggactcagatcgctgaggcgatcgag
cggaattacacgctcttcgacggattcgttgtcctccatggaaccgacagtctggcgtac
tcgtgctcggcgctcagctttatgctgcagaatctggggaagccggttgttcttactgga
tcgcaggcgcctatgcttgagctccagaatgatgctacggataatctgctcgggtcgttg
gttgttgcgggccatttcatgattcccgaggtgtgtttgtattttaataatcggttgttc
cgcggaaatcggacgacgaaggttgcggcgagtgactttgccgcgttcgatgcgccgaac
tgtgccccgttggcggttacgacttctatgcggactaatgttaattgggacatggtgcat
cgtcctacgagcttggcgccgtttagtattcagacaaatctggatactactcatgttgct
tgtctgcgtattttccccggtatcaagccagagatggtggatgcggtgctgaagctggat
ggcttgcgcgggttgattcttgagacttttggcgcgggcaatgcgccctccggtcaggat
aatgccatgatcaacgtcttggccagtgctatccagcgggggattgttatcgtgaacatc
acgcaatgcctcacgggcagcgtcagtccagtctatgccacaggcatgagtctctcacga
gcaggtgtcgtagccggcctcgacatgacaaccgagggagcattgacgaagctcgcctat
ctcctcgccctaccagaatcgacacccgaatccatcgccagacgcatggcagtatctctc
cgaggcgagctgaccgagtcatcattacctatcttccgacacccggacggcgccctcccc
gaacgcatccagacactcacatcgatggggtatgcgattgcccacggcgacctggagaag
gtccaagccatcaccaagaccgaacaccactggctcctaaacgacgccgactattccggc
aacacgcccatccacctggcagcaacctccccgtcaatcgaaatcctccacttcctccta
tcgcaaggcggctccgtgcacctccgcaatcgcgccggccgcaccccgctcttcctggcc
gcgaacgcgggtctctccgagcacacgctcctcctccgcaaatccggcgctcacctgcat
tcagatgagcgaccagccgccgagctactggcacgtcatcgtcccttcgtttggggtatg
gctggtgttgggccgaaagagatcagccagcgggagatggaggaggatgttgataagaac
cgggtgattcctgggtcggcgccttcttag

DBGET integrated database retrieval system