KEGG   Penicillium chrysogenum: Pc21g16610Help
Entry
Pc21g16610        CDS       T01091                                 

Definition
Pc21g16610
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
pcs  Penicillium chrysogenum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 549 aa AA seqDB search
MATPVPEEAKAEETAQESRVLIIMTGGTICMQPSPAGFIPARGFQEKCMARVPSFNDGSD
SATMDVVVNAVREVKEHPSLRTPMTAYGRQVRYTVFEFEELLDSSSIDAKGWTQIAEAIE
RNYTLFDGFVVLHGTDSLAYSCSALSFMLQNLGKPVVLTGSQAPMLELQNDATDNLLGSL
VVAGHFMIPEVCLYFNNRLFRGNRTTKVAASDFAAFDAPNCAPLAVTTSMRTNVNWDMVH
RPTSLAPFSIQTNLDTTHVACLRIFPGIKPEMVDAVLKLDGLRGLILETFGAGNAPSGQD
NAMINVLASAIQRGIVIVNITQCLTGSVSPVYATGMSLSRAGVVAGLDMTTEGALTKLAY
LLALPESTPESIARRMAVSLRGELTESSLPIFRHPDGALPERIQTLTSMGYAIAHGDLEK
VQAITKTEHHWLLNDADYSGNTPIHLAATSPSIEILHFLLSQGGSVHLRNRAGRTPLFLA
ANAGLSEHTLLLRKSGAHLHSDERPAAELLARHRPFVWGMAGVGPKEISQREMEEDVDKN
RVIPGSAPS
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggccactccagtgccggaagaagccaaagccgaggaaacggcacaagaatcgcgcgtt
ctaatcatcatgacaggcggcacaatctgcatgcagccctcaccagccggcttcatccca
gcgcgcgggttccaagaaaaatgcatggcgcgggtgccaagcttcaacgacggctcggac
agcgcaacaatggacgtggttgtcaacgccgtgcgcgaagttaaagaacatccaagcctg
cgcacaccgatgacagcctacgggcgacaggtacggtatacagttttcgagtttgaagaa
ctgctcgacagcagctcgatcgacgcaaagggctggactcagatcgctgaggcgatcgag
cggaattacacgctcttcgacggattcgttgtcctccatggaaccgacagtctggcgtac
tcgtgctcggcgctcagctttatgctgcagaatctggggaagccggttgttcttactgga
tcgcaggcgcctatgcttgagctccagaatgatgctacggataatctgctcgggtcgttg
gttgttgcgggccatttcatgattcccgaggtgtgtttgtattttaataatcggttgttc
cgcggaaatcggacgacgaaggttgcggcgagtgactttgccgcgttcgatgcgccgaac
tgtgccccgttggcggttacgacttctatgcggactaatgttaattgggacatggtgcat
cgtcctacgagcttggcgccgtttagtattcagacaaatctggatactactcatgttgct
tgtctgcgtattttccccggtatcaagccagagatggtggatgcggtgctgaagctggat
ggcttgcgcgggttgattcttgagacttttggcgcgggcaatgcgccctccggtcaggat
aatgccatgatcaacgtcttggccagtgctatccagcgggggattgttatcgtgaacatc
acgcaatgcctcacgggcagcgtcagtccagtctatgccacaggcatgagtctctcacga
gcaggtgtcgtagccggcctcgacatgacaaccgagggagcattgacgaagctcgcctat
ctcctcgccctaccagaatcgacacccgaatccatcgccagacgcatggcagtatctctc
cgaggcgagctgaccgagtcatcattacctatcttccgacacccggacggcgccctcccc
gaacgcatccagacactcacatcgatggggtatgcgattgcccacggcgacctggagaag
gtccaagccatcaccaagaccgaacaccactggctcctaaacgacgccgactattccggc
aacacgcccatccacctggcagcaacctccccgtcaatcgaaatcctccacttcctccta
tcgcaaggcggctccgtgcacctccgcaatcgcgccggccgcaccccgctcttcctggcc
gcgaacgcgggtctctccgagcacacgctcctcctccgcaaatccggcgctcacctgcat
tcagatgagcgaccagccgccgagctactggcacgtcatcgtcccttcgtttggggtatg
gctggtgttgggccgaaagagatcagccagcgggagatggaggaggatgttgataagaac
cgggtgattcctgggtcggcgccttcttag

DBGET integrated database retrieval system