KEGG   Penicillium chrysogenum: Pc21g17360Help
Entry
Pc21g17360        CDS       T01091                                 

Definition
Pc21g17360
Orthology
K10759  
tannase [EC:3.1.1.20]
Organism
pcs  Penicillium chrysogenum
Brite
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.20  tannase
     Pc21g17360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 580 aa AA seqDB search
MRLSWGASAAALAASASAASLADVCTVSNVQSALPSNGTLLGINMIPSTVTASPVYNASA
GMGSTETYTYCNVTVTYEHTGKGDSVVIKYAFPKPSDFKKRFYVAGGGGFSLSSDATGGL
EYGAVGGATSAGYDAFNNSYDEVVLYGNGTINWDATYMFAYQALGEMTKIGKVLTKGFYG
MASSAKVYTYYEGCSDGGREGMSQIQRYGEEYDGAITGAPAFRFAQQQVHHVFSAAAEQT
LDYYPPPCELAKIVNATIAACDPLDGRTDGVISRTDLCKLKFNLTSIIGEEYYCAAATST
SLGFGFSKRADGSSTSTTPEQSGKVTAKGVQVAQAIYDGLHNSKGERAYLSWQVGSELSD
GDTTWNNATSKWEMSIPSTGGEYVTKFIQLLDLDNLSDLDNVTYDTLVDWMNTGMVRYMD
SLQTTLPDLTPFQSSGGKLLHYHGESDPSIPSASSVHYWQSVRSIMYPHLSSQDSLKELA
DWYQFYLVPGAAHCGTNKLQPGPYPENNMQTMIDWVENDVKPSRLNATVSSGTYEGETQM
LCQWPTRPLWKSNSTFQCVDDKASIESWTYSFPAFKVPVY
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctctcctggggcgcgtctgctgcagcactagcagcgtcggcaagcgctgcttcg
cttgctgatgtctgcaccgtctcgaacgtgcagtctgccctgccctccaatggcactctg
ctgggtatcaacatgatcccttccactgtgactgccagccctgtctacaatgccagcgct
ggtatggggagcaccgagacctacacctactgcaatgtgacggtcacctacgagcacact
ggcaagggagactccgtcgtcatcaagtatgccttccccaagccctctgactttaagaag
cgcttctacgttgccggtggtggtggcttctctctgtctagcgatgcaactggtggtctc
gagtacggtgctgttggcggtgccactagcgcaggatatgatgccttcaacaacagttac
gacgaggtggtcctctacggaaacggaactatcaactgggacgcaacctacatgttcgca
taccaagctctgggtgaaatgaccaagatcggaaaggttcttaccaagggcttctatggc
atggcttcttccgccaaggtctatacctactacgaaggctgctctgatggcggccgtgag
ggtatgagccaaatccagcgctacggagaggagtacgatggagcgatcaccggagccccg
gctttccgcttcgcccaacagcaagtccaccacgttttctcagctgcagccgagcagacc
ctcgactactacccccctccctgcgagctggcgaagatagtgaacgctactatcgccgca
tgcgatcccctcgatggccgaaccgacggcgtcatctcccgcaccgacctctgcaagctc
aagttcaatctgacctccatcatcggcgaggaatactactgtgcagcagcaaccagcacc
tccttaggtttcggcttcagcaagcgcgccgacggcagcagcacctccactacacccgaa
cagagcggcaaagtcactgccaaaggtgtgcaagtcgcacaagccatctacgacggccta
cacaactcgaagggcgagcgcgcctacctttcctggcaagtcggctctgagctcagcgac
ggcgacacaacttggaacaacgcgaccagcaagtgggaaatgagcatcccctcgacgggc
ggcgagtacgtgaccaagttcatccagctccttgatctcgacaacctctccgacctcgac
aacgtcacctacgacaccctcgtcgactggatgaacaccggcatggtccgttacatggac
agtctgcaaaccactctgccggacttaaccccgttccaatcctccggcggaaaactcctg
cactaccacggtgaatccgaccccagtattccctctgcgtcttccgtacactactggcag
tccgtccgctccatcatgtacccgcatctgtcttcccaggatagtctcaaggaactcgcc
gattggtaccagttctacctcgtccccggtgctgcgcactgcggcacaaataagctgcag
cctggcccgtaccccgagaataacatgcagactatgattgattgggtggagaatgatgtc
aagccttctcgtttgaacgcgactgtctcatctggtacttatgagggtgagacgcagatg
ctttgccagtggcctactcgtccgctctggaagagtaacagcaccttccagtgtgttgat
gataaggcttccattgagagctggacttactctttccctgctttcaaggtgcccgtgtac
tag

DBGET integrated database retrieval system