KEGG   Penicillium rubens: Pc21g19760Help
Entry
Pc21g19760        CDS       T01091                                 

Definition
(RefSeq) Pc21g19760
  KO
K04709  Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
pcs  Penicillium rubens
Pathway
pcs00600  Sphingolipid metabolism
pcs01100  Metabolic pathways
Module
pcs_M00094  Ceramide biosynthesis
pcs_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Pc21g19760
Enzymes [BR:pcs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     Pc21g19760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAM_LAG1_CLN8 TRAM1
Motif
Other DBs
NCBI-GeneID: 8316724
NCBI-ProteinID: XP_002568967
UniProt: B6HJX4
Position
1
AA seq 441 aa AA seqDB search
MVRPRGSSALGVDIRGDTSAPAMSTMNEVSPIEPTSPDQKQFDGAQKQATKAQPKRRRSR
SLLHRFADTCLRYTWLLPLLLMLFLIALYAINPTPSNPMHSAIFLSYPQPPKTPGGPIMY
GKGKKDIAFVAFYTIVLSFMREFIMQQMIRPFAVWCGIRGKGKTARFMEQSYTAVYFGVF
GPFGLYVMKRSSIWYFNTTAMFEGFPHREHEGLFKAYYLLEASYWAQQAIVLMLQLEKPR
KDFKELVGHHIITLALIALSYRFHFTYMGLAVYITHDISDFFLATSKTLNYLDAYITAPY
FAMFVGWWIYLRHVLNLKILWAVLTEFRTVGPFELNWETQQYKCWISQYITFALLASLQA
VNLFWLFLILRILMNYIFTNVTKDERSEDEEEEEELEPVNATKAIATGVDETSKENHTPQ
VLVNGEPVAEQRGPRTRSRKA
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggttcgcccgcggggaagctcagccttgggcgtggacattcgtggtgacaccagcgca
ccagcgatgtccacaatgaacgaagtgagtccgatcgagccaacatcaccagatcagaag
caattcgatggcgcacaaaaacaggccaccaaggcccaacccaagcgacgtcgcagccgc
tccctcctccaccgcttcgccgatacctgtctgcgatacacctggctgctgccacttctc
ttaatgctcttcctgatcgcgctgtacgccatcaaccccacaccctcgaacccaatgcac
agcgccatcttcctgtcctacccgcagccgccgaagacccccggcggacccataatgtac
ggcaagggcaagaaggacattgcatttgtggcattctacaccatcgtgctgtcgttcatg
cgcgaattcatcatgcagcagatgatccgaccatttgcggtgtggtgcggtatccgcggg
aagggaaaaacggcgcggttcatggagcagtcatatacggcagtgtacttcggtgtgttc
gggccgtttggtctgtacgtgatgaagcggtcgagtatctggtacttcaacacgacggcg
atgtttgagggcttcccgcaccgcgagcacgagggtctgttcaaggcatactacctgctc
gaggcgagttactgggctcagcaggcgattgtgttgatgctgcagttggagaagcctcgt
aaggacttcaaggagcttgttggtcatcatattatcacgcttgcgcttatcgcgctgagc
taccgcttccacttcacgtacatgggcttggcggtgtatatcacgcacgatatctctgat
ttctttttggccacctctaagacattaaattatctggatgcgtatatcactgcgccctac
tttgccatgttcgtggggtggtggatttacctgcgtcacgtgctgaatctgaagatcctc
tgggctgttctgactgagttccgcactgtcggaccattcgagctgaactgggagacacag
cagtacaagtgctggatcagtcagtacatcacctttgcactgcttgccagtctgcaggct
gtcaacctgttctggctgttcctgatcctgcgcattctgatgaactacatcttcaccaac
gtcacaaaagacgagcgtagcgaggacgaagaggaagaagaggagctcgagcctgttaac
gcgaccaaggcaattgccactggcgtagatgagaccagcaaggagaaccacactccccag
gttctggtcaacggcgagcccgtcgccgaacagcgtggtcctcggacccgcagcagaaag
gcctaa

DBGET integrated database retrieval system