KEGG   Penicillium chrysogenum: Pc21g20310Help
Entry
Pc21g20310        CDS       T01091                                 

Definition
Pc21g20310
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
pcs  Penicillium chrysogenum
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Pc21g20310
   00240 Pyrimidine metabolism
    Pc21g20310
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Pc21g20310
   03410 Base excision repair
    Pc21g20310
   03420 Nucleotide excision repair
    Pc21g20310
   03430 Mismatch repair
    Pc21g20310
   03440 Homologous recombination
    Pc21g20310
DNA repair and recombination proteins [BR:pcs03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      Pc21g20310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 185 aa AA seqDB search
MPRRAANKPGSQSTLSFGARGRVTKPVTAPSHKAKALDSTPALSDQSASATPEPQQLAVT
PNEPSKPHVADLAVRQQAAIEHQAPQSEEDKRALKLNKQDIWRYWQAQEQIRKAPRAHQQ
GMDVEEKILRHFDLSSQYGPCVGIARIKRWRRANQLKLNPPIEVLAVLLKGKNVKERAHI
DELLS
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtcgcgcagcaaataaacccgggtcacagtcgacactgtccttcggggcccgt
ggccgggtcactaaaccagtcaccgcaccatcccacaaagccaaggccctcgactcaact
ccagcgctctccgaccaatctgcctccgccaccccagagccccagcagctggccgttacc
ccgaacgagccctccaaaccccatgtcgcagacctagcggtgcggcagcaggccgcaatc
gaacaccaagcgcctcaatctgaagaggacaagcgggcactcaagttgaacaagcaggat
atctggcgatactggcaggctcaagagcagatccgcaaggcacctagggcccatcagcag
ggtatggacgtggaggagaagattctccggcattttgatctttcaagccaatacgggccc
tgcgttggaatcgctcgaatcaagcgctggagacgggccaatcagttgaagctcaaccca
cctatcgaggtccttgcggttcttctcaagggcaagaatgtaaaggagcgagcacatatc
gatgaattgctatcctga

DBGET integrated database retrieval system