KEGG   Penicillium chrysogenum: Pc21g20400Help
Entry
Pc21g20400        CDS       T01091                                 

Definition
Pc21g20400
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
pcs  Penicillium chrysogenum
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Pc21g20400
  Lipid metabolism
   00561 Glycerolipid metabolism
    Pc21g20400
   00600 Sphingolipid metabolism
    Pc21g20400
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    Pc21g20400
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Pc21g20400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 746 aa AA seqDB search
MVYLTRGVVATGLTLLAHSVAVTAKESSASPIVADGTHFALNGKNVAYRFHVDNTTGDLL
GDHFGGSVGDNIPLEVIGEVNGWVSDIGRVRREFPDQGRGDYRVPAISIRQSEGYTVSEF
RYKSHKIIPGKPALPGLPATMGTEEDVSTLVISMYDKYSDVAADLSYSIFPKHDAIVRSV
NVTNHGTGNITIESLASLSVDLPYEDLDMINLRGDWAREAQRERRSVAYGLQSFGSSNGY
SGHLHNPFLALTEPSTTESQGEAWGFSLVYTGSFTVNVEKGSQGFTRALMGFNPSQLSWV
LPPGETLTSPECVSVYSKDGIGGMSRSLHRLYRNHLIKSKFATSDRPTLLNSWEGLYFDF
NQSSIYDLAKEAAGVGAKLFVLDDGWFGKEYPRLSDNAGLGDWVPNPDRFPDGLEPLVKK
ITDLKAANTSTNMRFGIWFEPEMVNPNSTLYDEHPDWALHAGPYPRTEARNQLVLNLALP
EVQDYIIKSVSDVLKSADISYVKWDNNRGINETPSPATNHAYMLGMYRVFNELTTQFPDV
LWEGCASGGGRFDPGVLQYFPQIWTSDNTDAIDRISIQLGTSLAYPPSAMGAHLSEVPNH
QTGRTVPVAVRAHVAMMGGSFGLELNPAVMDEEDKAAVPGLVALAEKVNPIILNGDMWRL
NLPEDSNWPAVLFIAEDARNAVLFVFQVAPNVNHSWPRIKLQGLDPQASYKVDDGVVYTG
ATLMNIGLQFAFKGDYGSQVVMLEKQ
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atggtttacctaacaaggggtgtggtggccacaggccttactctccttgcgcattccgtc
gccgttacggctaaggaatcgagcgcaagtccaattgtggcagatggtactcactttgct
ctgaacggaaagaatgttgcgtaccgcttccatgtggacaacaccactggtgatctccta
ggagaccactttggaggctccgtcggagataatatccctctggaggttataggagaggtt
aatggctgggttagtgacattgggcgtgtacgccgcgagttcccagaccagggccgcgga
gactaccgtgtccctgcgattagcattcgtcagtcagaagggtataccgtgtctgaattc
cggtataaatcgcacaagatcatccctggcaagcctgctctacctgggttgccagccacc
atgggcacagaagaagacgtgagcaccttggtcatcagtatgtatgacaagtacagcgat
gttgccgcggacctctcctactcgattttccccaagcacgatgccattgtgcgcagcgtg
aatgtcacgaaccacggaacgggaaatatcacaatcgagtctctggccagtctgagcgtg
gacttgccgtatgaggacctggacatgattaatcttcggggagattgggcaagggaagcg
cagcgcgagaggcggagcgtggcatacggcctccagagctttggaagttccaatggctac
tctggtcacctccataatcctttcctggcattgacagagccctccaccaccgagtctcaa
ggagaggcatggggattctcgcttgtgtacaccggttcattcaccgtcaacgtcgagaag
ggttcacagggtttcacacgtgccctgatgggcttcaaccccagccagctttcgtgggtc
ttaccgccaggggagactcttacctccccagagtgtgtctcggtatactccaaggatggc
atcggtggaatgtcacgctccctgcatcgcttgtaccgcaaccatctcatcaagagcaag
tttgccaccagtgaccgtcccaccttgctgaacagttgggaaggattgtatttcgatttc
aaccagagcagcatctacgacctggcaaaggaagctgccggggtaggcgccaaactcttc
gttttggatgatggctggttcggcaaggaatacccacgtctctccgacaacgccggactg
ggtgactgggtcccaaatcctgaccggttcccagacggcctggagccccttgtgaagaag
atcacggacctgaaagccgctaacacatcaacgaacatgcgcttcggtatctggttcgag
ccggaaatggtcaacccgaactcaactctgtatgacgagcaccctgactgggccttgcac
gcaggaccctaccctcgtaccgaagctcgcaaccagcttgtgttgaacctcgctcttcct
gaagtccaagactacatcatcaagtccgtctcagacgttctcaagagtgccgatattagt
tacgtcaagtgggataacaacaggggcatcaacgaaacgccttccccagccacaaaccat
gcctacatgctcggcatgtaccgcgtattcaatgaactcacgacccaattccccgatgtt
ctctgggagggttgcgcgtcgggcggagggcgtttcgaccccggtgttctgcagtacttc
ccacagatctggacatccgacaacacagacgccatcgatcgcatctccattcagcttggt
acttcgctcgcctacccgcccagcgcgatgggtgctcacctgtccgaagtgccgaaccac
cagactggccgcacagtgcccgtggctgttcgagcacacgttgcgatgatgggtggttcc
tttggcttggagctcaatccggctgtaatggacgaggaggacaaggctgctgtgccgggg
ctcgttgctctcgctgagaaggtgaaccccattattctcaatggtgatatgtggcgattg
aaccttccggaggactcgaattggcctgctgtcttgttcatcgctgaggatgctcggaac
gctgttttgtttgtcttccaggtcgctccgaatgttaaccattcatggccgcgcattaag
ttgcagggattggatccgcaggcttcctataaggttgatgacggtgtggtttacaccggt
gccacgttgatgaatattggtctgcaatttgccttcaaaggtgactatggcagtcaagtc
gtgatgttggagaagcaatag

DBGET integrated database retrieval system