KEGG   Penicillium rubens: Pc21g21700Help
Entry
Pc21g21700        CDS       T01091                                 

Definition
(RefSeq) Pc21g21700
  KO
K10739  
replication factor A2
Organism
pcs  Penicillium rubens
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Pc21g21700
   03420 Nucleotide excision repair
    Pc21g21700
   03430 Mismatch repair
    Pc21g21700
   03440 Homologous recombination
    Pc21g21700
DNA replication proteins [BR:pcs03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    Pc21g21700
DNA repair and recombination proteins [BR:pcs03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     Pc21g21700
   MMR (mismatch exicision repair)
     Pc21g21700
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     Pc21g21700
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 276 aa AA seqDB search
MDGSYNNYNSFGGGGGGGFMPGETNSPAGGKTFDRDNKTLRPVTVKQVLDASQPFPEAPF
QVDGADVANVLFMGQVRNISSQSTNVTYKIDDGTGEIEVKKWVDSTTADNMDTDDGKAPG
DGKTELELNGYARVFGSIKSFGNKRYIGAHSVRPLSNINELHTHLLEATAVHLFFTRGPP
GGAAPGGNAGGDAVMGGADDYGSGQNKALASMSLVAKKIYNLLKTEPQDDTGLHMQVIAS
KLNMPATEVARAGEELLGAGVIFSTMDEQTWAILEY
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggacggcagttacaacaattataactcattcggcggcggcggtggtggaggattcatg
cccggcgagacgaacagtcccgccggaggcaagaccttcgaccgggacaacaaaaccctc
cgtcccgtgacagtgaagcaagtccttgacgcctcgcaacccttccccgaagccccattc
caagtcgacggcgccgacgtcgccaacgtcctcttcatgggccaagtacgcaacatcagc
tcgcagagcacaaacgtgacatacaagatcgacgatggcacgggcgagatcgaagtcaag
aaatgggtcgactcaaccactgcagacaacatggacaccgacgacggcaaggcgcccggc
gatgggaagactgaacttgagcttaacggttacgcacgggtctttggatccatcaagtcc
tttggtaacaagcggtacattggtgctcattctgtccggcccttgtcgaatatcaacgag
ctgcatactcatctgctcgaggctactgctgtgcacttgttcttcactcgtggtccgccc
ggtggcgctgctcctggcggcaatgctggcggtgacgctgttatgggtggtgcggatgac
tacggttctgggcagaacaaggctcttgcttccatgtcgcttgtcgcgaagaagatttat
aacctgcttaagacggagcctcaagatgatacgggtctacacatgcaggtcatcgcttct
aaattgaacatgcctgcgactgaagtggctagggctggtgaggagttgcttggtgctggt
gtgatcttctccaccatggatgagcagacctgggcgattctagaatactag

DBGET integrated database retrieval system