KEGG   Penicillium chrysogenum: Pc21g21700Help
Entry
Pc21g21700        CDS       T01091                                 

Definition
Pc21g21700
Orthology
K10739  
replication factor A2
Organism
pcs  Penicillium chrysogenum
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Pc21g21700
   03420 Nucleotide excision repair
    Pc21g21700
   03430 Mismatch repair
    Pc21g21700
   03440 Homologous recombination
    Pc21g21700
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 276 aa AA seqDB search
MDGSYNNYNSFGGGGGGGFMPGETNSPAGGKTFDRDNKTLRPVTVKQVLDASQPFPEAPF
QVDGADVANVLFMGQVRNISSQSTNVTYKIDDGTGEIEVKKWVDSTTADNMDTDDGKAPG
DGKTELELNGYARVFGSIKSFGNKRYIGAHSVRPLSNINELHTHLLEATAVHLFFTRGPP
GGAAPGGNAGGDAVMGGADDYGSGQNKALASMSLVAKKIYNLLKTEPQDDTGLHMQVIAS
KLNMPATEVARAGEELLGAGVIFSTMDEQTWAILEY
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggacggcagttacaacaattataactcattcggcggcggcggtggtggaggattcatg
cccggcgagacgaacagtcccgccggaggcaagaccttcgaccgggacaacaaaaccctc
cgtcccgtgacagtgaagcaagtccttgacgcctcgcaacccttccccgaagccccattc
caagtcgacggcgccgacgtcgccaacgtcctcttcatgggccaagtacgcaacatcagc
tcgcagagcacaaacgtgacatacaagatcgacgatggcacgggcgagatcgaagtcaag
aaatgggtcgactcaaccactgcagacaacatggacaccgacgacggcaaggcgcccggc
gatgggaagactgaacttgagcttaacggttacgcacgggtctttggatccatcaagtcc
tttggtaacaagcggtacattggtgctcattctgtccggcccttgtcgaatatcaacgag
ctgcatactcatctgctcgaggctactgctgtgcacttgttcttcactcgtggtccgccc
ggtggcgctgctcctggcggcaatgctggcggtgacgctgttatgggtggtgcggatgac
tacggttctgggcagaacaaggctcttgcttccatgtcgcttgtcgcgaagaagatttat
aacctgcttaagacggagcctcaagatgatacgggtctacacatgcaggtcatcgcttct
aaattgaacatgcctgcgactgaagtggctagggctggtgaggagttgcttggtgctggt
gtgatcttctccaccatggatgagcagacctgggcgattctagaatactag

DBGET integrated database retrieval system