KEGG   Penicillium chrysogenum: Pc21g22230Help
Entry
Pc21g22230        CDS       T01091                                 

Definition
Pc21g22230
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
pcs  Penicillium chrysogenum
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    Pc21g22230
Enzymes [BR:pcs01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     Pc21g22230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 479 aa AA seqDB search
MRRLHVTPSVEPFSIAATVSLKNYRRTSRKNSRLAHSTSSKRVTWGRTCDHQSWLRTLFW
STPVVIAPMLALSCFLALAGYDGSLFKLFAAVLKDGLLPVLHTHGPRITLRAMAAIIFWL
AFQAVLYHYLPGPSNTGQRTPAGHLLTYRMNGLLAWVITHVAFIALCYLDLLDPAFIPRN
WEGLFAAMNLAGFGLSLIAYLKAYLMPTHPEDRKFSGCALYDFYMGIELNPRIGDNFDLK
LYTNGRPGLIAWTLVDLSNIAYHYQIHRHTSPSLILVTILHGIYVLDFFINEAWYLRTID
IAHDHYGFYLAWGCLTWVPSMYTLQTQFLGLYPTSASPVFLILIFSIGIAGYALFRSVND
QKDRVRRSDGKALVWGKPAEFIVAKYKTSDGAEHQSLLLCSGWWGWSRHANYVGDLLLSF
SMCALVHTTSLLVWFYIIFMAVLLVHRCLRDEERGQAKYGVFWEEYCRRVPWRLMPGIW
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgagaagacttcacgtaaccccaagtgttgaacctttttcgattgcagcaacggtgagc
ttgaagaattaccgtcgaacctcgcgcaaaaacagccgactcgcgcactctacaagttcg
aagagagtcacctgggggcggacttgcgatcatcaatcctggctgcgcacccttttttgg
tctactccagtggttattgctccaatgctggctctatcatgctttcttgcgctggccggg
tatgatggatctctcttcaagctatttgcagcagttctcaaagacggacttctgcccgtt
ctacatactcatggtcctaggatcactctccgggctatggccgcaattatattctggctt
gcctttcaggctgtgctataccattatctaccgggtcctagcaatacgggccagcgtact
ccagccggtcatctgttaacatatcggatgaacggtctcctggcgtgggtaataactcac
gttgccttcatcgccctatgttacttggaccttctagacccggcatttattccgcgtaat
tgggaaggactgtttgctgccatgaatcttgctgggtttggtctttctttaatagcgtac
ctcaaggcatacctgatgcctacgcacccagaggatcggaagtttagcggctgcgctctc
tatgacttctacatgggcatcgaactaaatcccaggattggggataacttcgacctcaaa
ctttataccaatggaagacctggtctgatcgcatggacattggtagacttgtctaacatt
gcataccactatcaaatccatcgtcacaccagtccatccctgatcttagtaaccattctc
catggtatctatgtactcgacttcttcatcaacgaagcctggtatctccgcacaatcgac
atcgcccacgatcactacggcttctatctcgcctggggctgcctcacctgggtcccgtct
atgtacacattacagacccaattcctcggcctttaccccacatcagcgtctccggtcttt
ctaatcctcatcttcagcattggaattgcgggttatgcattgttccgatccgtcaacgac
cagaaagatcgcgtgcggcgttccgacgggaaagccctggtctggggcaaacccgccgag
ttcatcgtcgcgaagtacaagacgtcggatggtgctgagcaccagagtctcttgctgtgc
agcggctggtggggctggtcacgtcatgcaaattatgtcggggacttgttgctgagcttt
tctatgtgtgcgctcgtccacaccacgtcgctcttggtctggttctacattatattcatg
gcggtattgctcgtgcatcggtgcctccgggacgaggagcgagggcaggcaaagtatggg
gttttctgggaggagtattgccggagggtcccttggcgactgatgccgggcatttggtga

DBGET integrated database retrieval system