KEGG   Penicillium chrysogenum: Pc21g23400Help
Entry
Pc21g23400        CDS       T01091                                 

Definition
Pc21g23400
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
pcs  Penicillium chrysogenum
Brite
Enzymes [BR:pcs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Pc21g23400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 659 aa AA seqDB search
MSTPSTATATHPSHHQAYGYPHHPSYQPNTSYPTSTAAGTRLANPYAISVPSPTTTTLPY
TQPPRIPPATTTPSAMTHQSGSSAAPSVGGRRKKPDWTEFYKNGLPKEVIVIDDSPGPEP
SNGAAASHVTTSARPPPAAPQPAGKRRRTGIDTAYDLGHYDRPSFSINPQHYGEESSVTS
LSTDRTASLHTTAPTSLGSQGSSGASNGVYYEDGSVGNKRKRATRKSTRDEQKRRELETA
GDAFLSYVPPPKPPIKAKDVPVPVVRDYTSSQNRKFDDDDGHYIVTPDTPLTDRYSVIKL
LGQGTFGKVVEAFDKQRKSRCAVKIIRSIQKYRDASRIELRVLSTLASNDKHNRNKCIHL
RDCFDFRNHICIVTDLLGQSVFDFLKGNGFVPFPSSHIQQFARQLFTSVAFLHDLNLIHT
DLKPENILLVSSAYQTFTYNRTIPSSSQATTRSARQRRVLLDGEIRLIDFGSATFDDEYH
SSVVSTRHYRAPEIILNLGWSFPCDIWSIGCILVEFYTGDALFQTHDNLEHLAMMEAVIG
SRIDTALVKKVMAGRGGGSSSNSASKYFNRSKIDYPSAETTRASRKYVRAMKPLTEFIPT
NTPFNRSFLDLLQQIFVYDPKNRITAKEALKHPWFKETLVDDGTEAYRIGQGLQRQART
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccccgtctacggctactgcaacacatccttctcatcatcaggcttacggatat
cctcaccacccttcgtatcaaccgaacacctcctacccgacttcgaccgcggcaggaact
cgcctcgcgaatccctacgccatttccgtcccctctccgacaacgaccacccttccctac
acccaacctccgcgaattcctcccgcgacaacaactccgtccgctatgacccaccagagc
ggctctagtgcggctccctccgttgggggtcggagaaagaaaccagactggaccgagttc
tacaagaatggccttcccaaggaagtcattgtgattgatgacagtcctggtccagagcca
tccaatggtgccgcggcttctcatgtcactacttctgccagaccacctcctgcggctcct
cagcccgctggaaagaggcgacggacgggaattgataccgcctatgacctgggccactat
gaccgcccgtccttttcaatcaatccccagcattacggcgaggaatcctccgtcacgtcc
ttgtcgaccgatcgaaccgcatccttgcacacaaccgctccaacgtcgcttggttcacag
ggcagttccggggcgagcaatggtgtttactatgaggatggctctgtcggtaacaagcgg
aaacgcgccactcggaaatccacccgcgacgagcagaagcgacgagagttggagaccgca
ggtgatgctttcctgagttatgtcccacctccaaagccgccgatcaaagcgaaggatgtc
cctgtgccggtcgttcgtgattacaccagttcccagaacaggaagttcgatgacgacgac
ggccattacattgtcacacccgacacgccattgacagatcgatactctgtgattaaactc
ctaggccaaggcacgttcggcaaagttgtcgaagccttcgacaagcagcgaaagtctcgc
tgtgcagtcaaaatcatacgctcgatccaaaagtatcgcgacgcatctcgaatcgagctg
cgagtcttgtcaactctggcttcgaacgacaaacacaaccgcaacaagtgcatccacctt
cgggactgtttcgacttccggaatcacatttgcattgtcactgatctactaggacaaagc
gtatttgatttcctcaaggggaatggctttgtgccattcccgagcagccatatccagcag
tttgcccggcagctgttcacaagtgttgctttccttcatgacctaaaccttatccatacc
gaccttaaacccgaaaacatcctcctcgtcagcagcgcctaccaaaccttcacttacaac
cgcactataccatcctcttcccaagccacaactcgtagcgcgcgtcagcgccgcgttctc
ctcgacggtgaaatccgactcatcgacttcggttcggcgaccttcgatgacgaataccac
tcatctgtcgtctctacccgtcattaccgggccccggaaatcatcttgaacctgggctgg
agcttcccatgtgatatctggagtattgggtgtatcttggtggaattctacaccggagac
gccctgttccagacacacgacaacctggaacacctggcgatgatggaagccgtcattggc
agtcgaatcgacaccgctttggtgaagaaagtcatggcaggccgaggcggtggcagtagt
agcaactctgcttccaagtacttcaaccggagcaagatcgactatcccagcgccgaaact
acccgggcctcgcggaagtatgtgcgcgcgatgaagcctttgacggagttcatccctaca
aacacaccattcaaccgttcattcctggatttgttgcaacagatctttgtgtacgatccc
aagaaccggattactgcaaaggaggcgttgaagcacccgtggttcaaggagacactcgtc
gatgatggcacggaagcctaccggatcggccaaggattgcaacgacaagcacgcacctag

DBGET integrated database retrieval system