KEGG   Penicillium rubens: Pc22g00820Help
Entry
Pc22g00820        CDS       T01091                                 

Definition
(RefSeq) Pc22g00820
  KO
K01181  endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
pcs  Penicillium rubens
Brite
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Pc22g00820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_10 CBM_1 Ribonuclease
Motif
Other DBs
NCBI-GeneID: 8306574
NCBI-ProteinID: XP_002564127
UniProt: B6HPJ6
AA seq 396 aa AA seqDB search
MVHFSTIALALASALPQLTQGAGLHTSAVAKGKLYFGSATDNPELTDVPYLTQLSNTDDF
GQITPGNSQKWDALEPSQNTFSYTNGDVIANLAAKNGQKLRCHTLVWHSQLPSWVSSGSW
TNATLIAAMKNHITNVVTHYKGKCYAWDVVNEALNEDGTYRDSVFYKYIGEAFLPIAFAT
AAAADPDAKLYYNDYNIESPGSKSSGAQRIVKLVQQYGAKIDGVGLQAHFIVGSTPSQSA
QTTNLAAFTALGVDVAYTELDIRMTLPSTTALLTQQSTDYKNTVAACMANTKCVGITIWD
YTDKYSWVPSTFPGQGDACPWDKNLVKKPAYAGILAALGGTSSTTTTLVTSTTTAGSGGA
TRVPLYGQCGGSGWTGGTTCASGTCKHINDWYSQCL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggttcatttctctaccattgccctggcgttggccagtgcccttcctcagttgacccaa
ggagccggcttgcacacctctgctgttgcaaaggggaagctatacttcggatcagccact
gataaccccgagttgactgatgttccgtaccttacccaactgagcaacacagatgacttc
ggccaaattacaccgggcaattcgcagaagtgggatgcacttgagccgtcccaaaacacc
ttctcctataccaatggagatgtcattgccaaccttgctgctaagaatggccaaaagctg
cggtgccatactctggtttggcatagccaattgcccagctgggtctcaagtggctcctgg
accaacgcaactctgattgctgccatgaaaaaccacatcaccaacgtggtcactcactac
aaaggcaaatgttacgcttgggatgttgtcaatgaggctcttaacgaggacggtacctat
cgtgacagtgtcttctacaaatacatcggcgaggcattccttcccatcgcgtttgcaaca
gcagccgccgcagatccagacgccaagctctactacaacgactacaacatcgaatcaccc
ggttccaagtcatcaggtgcccagagaatcgtcaagctggtgcagcagtacggtgccaag
atcgacggtgtcggactgcaggcacactttattgtcggaagtacccctagtcagagcgcg
cagactaccaacctagccgcattcacagccctgggagttgacgttgcctacactgaactc
gacatccgtatgactctgccatcaactactgccttgcttacccagcagtccaccgactat
aaaaataccgttgcggcgtgcatggcaaataccaagtgcgttggcattactatttgggac
tacacggataaatactcgtgggttccgagcacattccctggtcagggtgatgcgtgtcct
tgggataagaacctcgtgaagaagcctgcttatgctggtatcttggctgctctgggcggt
acgtcctccactactactactctggttactagcacgactaccgccggttctggcggtgct
actagagtcccgctctatggtcagtgtggtggctcgggctggactggaggcacaacttgc
gccagtggaacctgcaaacacatcaatgactggtactcgcagtgtctatag

DBGET integrated database retrieval system