KEGG   Penicillium chrysogenum: Pc22g01570Help
Entry
Pc22g01570        CDS       T01091                                 

Definition
Pc22g01570
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
pcs  Penicillium chrysogenum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 494 aa AA seqDB search
MATLDSVQLLSEAAFGCVHLAAILSKDEKTADQFREEFCRQYKLLAPFSKTETVAVPTTG
LRTVASLKPKYHCLSCAEVCLGSKRAEHTAATGHVFYMESRNRFVFCEKCVDFIYDHTLD
RLRGPSGRFEAIDGRSIWAEDSASEVYVKNNAYKNPCAIRGARGVWNMGQTCYQASILQA
LLHDPSLTAYFLGGGHDVHTCIIKDCLACATAEVFMEFNSAEKSEAVSAAVLLHHGWQKS
KEMRGYRQQDAHEYFQFLVNELHSSTPGHVESYDKPCECFFHQMFYGELRSSVMCHKCGQ
TTNTHDPMADLSLDVQLQQKKRKLGRSTSSSTSGTLLGCLDSFTAAEDLHADAAYHCEKC
GNTPQRASKRLQIRKLPVMLCMQLKRYEHSSNSSEKMNGHIDFPLSVNMLPYTVRKDSLP
VDMSNYIYDLSTVIVHQGTMDSGHYYAYTRIENDKWVLMDDNKVTIAGVAEVLRQDAYLL
FYSARYLRAEKTKK
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggcaactctcgattccgtccagcttctttctgaagcagcatttggctgtgtacatctt
gcggctattctctccaaggacgagaagactgctgaccagttcagagaggaattctgcagg
caatacaaattgctagctccgttctcaaaaacagaaacggttgctgttccaaccaccggc
ctccgcactgtggcatccctcaagccgaagtatcactgtttgagttgtgcagaagtatgt
ctgggttccaagcgagcggaacatactgcggcgactggacatgtattttatatggagtca
cgcaaccgctttgtcttttgtgagaagtgtgtggatttcatctatgatcacacattggac
agactccgtggcccttctggcaggtttgaagccattgatggacgatccatttgggctgaa
gactctgcctccgaggtctacgtcaagaacaatgcttacaagaacccttgcgccatccgc
ggtgctcgtggtgtctggaacatgggtcaaacgtgctatcaagcttctattttgcaggct
ctgttgcacgaccctagcctcactgcctatttcttgggaggtggccatgacgtccacaca
tgcataatcaaggactgtctcgcctgtgcgacagctgaagtcttcatggaattcaacagc
gctgagaaaagcgaggcagtttccgcagccgtgcttcttcaccatggttggcagaaatcc
aaggaaatgcgtggataccgccagcaagacgcccacgaatacttccaattccttgtcaat
gaactgcactcatctactcccggacacgtggagagctacgataaaccatgcgagtgcttc
ttccatcagatgttctacggcgaactgcgcagcagcgtcatgtgccacaaatgtggccaa
accaccaacacccacgaccccatggccgatctcagtcttgatgtacagcttcagcaaaag
aagcgcaagctcggtcgctctacttcttcttctacttctggaaccctcctcggctgcctg
gacagcttcactgccgctgaagatctccacgccgatgctgcttaccactgcgagaagtgt
ggtaacaccccgcagcgggcttcgaagcgtctgcagatccgcaaactccctgttatgctt
tgcatgcaactgaagcgctacgaacactcctctaactcatccgagaaaatgaacggccac
atcgacttccctttgtctgtgaacatgttgccttacaccgtcagaaaggatagcctccct
gtcgacatgtcgaattacatttacgacttgtctactgtcatcgtccaccaagggacaatg
gactctggacattactacgcctacacccgtattgaaaacgacaagtgggtactgatggat
gacaacaaggtcaccatcgccggtgtggctgaagtcctccgccaggatgcctatctcctg
ttttacagcgctcgttatctccgggccgagaagacaaagaagtaa

DBGET integrated database retrieval system