KEGG   Penicillium chrysogenum: Pc22g01660Help
Entry
Pc22g01660        CDS       T01091                                 

Definition
Pc22g01660
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pcs  Penicillium chrysogenum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pc22g01660
Enzymes [BR:pcs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Pc22g01660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 294 aa AA seqDB search
MPPTPILLLKTKSSPHDGYEDFFSAHNYTPTFIPVLEHRFLKNNLTQVRDLFSTGAFNNA
TRKYGGLIFTSQRAVEGFAQMIEEEKDVQFNTPTSPPLLLYTVGPATARTLTTLRDKHLP
NATIHGADTGTGENLAHFILSHYDSIYTTHKPSLLFLVGEVRRDIIPKTLMDKALPVDKR
VGVEELVVYETGVMESFEGDFADVVGRSDGAVWVVVFSPTGCEAMLRVLGLGPFAGSGCG
DGAAAGTRQVFVATIGPTTRDHLREKFGFEAHVCAPKPSPEGVLEGIAKFMGGI
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcctccaacaccaattctcctcctgaaaacaaaatcctccccacacgatggctacgaa
gacttcttctccgcacacaactacaccccaaccttcatccccgtcctagaacaccgcttc
ctcaaaaacaacctcacccaagtgcgcgacctattcagcaccggcgcattcaacaatgcc
accagaaaatacggcggtctaatcttcaccagccaacgcgcagtcgaaggctttgcgcaa
atgatcgaagaagaaaaagacgtccaattcaacaccccaacctccccacccttactcctg
tacaccgtgggcccagccacagcgcgcacactcacaaccctccgcgataaacacctcccg
aatgcaacaatccacggcgcggacacaggcacaggcgagaatctcgcgcatttcatactc
agccactatgattccatctacaccacacacaaaccctctctcctttttcttgtcggggaa
gtgcggagggatatcatcccgaaaacgctaatggataaagcattaccggttgataagcgg
gttggtgttgaggagctcgttgtgtacgagaccggggtgatggagtcgtttgagggggat
tttgcggatgttgtaggtaggtcggatggggcggtttgggtggttgttttctcgccgact
gggtgtgaggctatgttgagggttcttggtttggggccttttgctggttctggctgtgga
gatggagctgcagctgggacgcggcaggtctttgttgctactattgggcctacgacgcgg
gatcatctgcgtgagaaatttgggtttgaggcgcatgtttgtgcacctaagcctagtcct
gagggtgtgcttgaggggattgcgaagtttatgggtgggatttga

DBGET integrated database retrieval system