KEGG   Penicillium chrysogenum: Pc22g01670Help
Entry
Pc22g01670        CDS       T01091                                 

Definition
Pc22g01670
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pcs  Penicillium chrysogenum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 354 aa AA seqDB search
MGHQGPPAGGSRKISFNVSDQYEIQDVIGEGAYGVVCSAIHKPSGQKVAIKKITPFDHSM
FCLRTLREMKLLRYFNHENIISILDIQRPRNYEGFNEVYLIQELMETDMHRVIRTQDLSD
DHCQYFIYQTLRALKAMHSANVLHRDLKPSNLLLNANCDLKVCDFGLARSAASTDDNSGF
MTEYVATRWYRAPEIMLTFKEYTKAIDVWSVGCILAEMLSGKPLFPGKDYHHQLTLILDV
LGTPTMEDYYGIKSRRAREYIRSLPFKKKIPFRALFPKSNDMALDLLEKLLAFNPAKRIT
VEEALKHPYLEPYHDPEDEPTAPPIPDGFFDFDKNKDALSKEQLKLLIYEEIMR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggtcatcaaggccctcccgcgggaggatcccggaagatctccttcaatgtatccgat
caatacgagatccaagatgttatcggcgaaggcgcctatggtgtcgtctgctctgccata
cataagccctccggccagaaggttgccatcaagaagatcacgccattcgatcattccatg
ttctgcctacgtacactgcgtgagatgaagttgctgcgatactttaaccatgaaaacatt
atctccatcctggatattcaacggccccgtaactacgagggattcaatgaagtttatctg
attcaagagttgatggaaacagacatgcatcgggttatccgcacacaagatctctcagac
gaccactgccaatactttatctaccagaccctgcgtgcgctcaaggcaatgcactcggcc
aatgtcctccatcgagatttgaagccctccaatcttttgctcaatgccaactgcgacctg
aaagtctgcgacttcggtctggctcgctcggccgcctccaccgacgacaactccggcttc
atgacagaatatgtggctacacgttggtaccgtgcgccggagatcatgttgacattcaaa
gaatacaccaaggctattgacgtgtggagtgtcggctgcatattggctgagatgctgagc
ggaaagcccctcttccctggcaaggattatcaccatcagttgaccctcatcttggatgtc
ctcggcacacccacgatggaagattactacggcatcaaatctcgccgtgcccgcgaatac
atccgctccctcccctttaagaagaagattcccttccgtgcactcttccccaagagcaat
gacatggctctggatttgctcgagaagctgctcgctttcaacccggctaagcgtatcact
gtcgaggaagccctgaaacacccctacctcgagccgtaccatgatcctgaagatgagccc
actgcaccacccattcccgatggattcttcgatttcgacaagaacaaggatgctctgagt
aaggagcagctgaagctcttgatctatgaggaaatcatgcggtaa

DBGET integrated database retrieval system