KEGG   Penicillium rubens: Pc22g01850Help
Entry
Pc22g01850        CDS       T01091                                 

Definition
(RefSeq) glucan 1,4-alpha-glucosidase BAC8255-Penicillium chrysogenum
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
pcs  Penicillium rubens
Pathway
pcs00500  Starch and sucrose metabolism
pcs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pc22g01850
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Pc22g01850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-GeneID: 8312434
NCBI-ProteinID: XP_002564229
UniProt: B6HPB5
AA seq 488 aa AA seqDB search
MLTLNVLTALLAPGVLSSALPARDLNARADSKPAALQAILNNIGADGSAVSGASAGVVVA
SPSKSDPDYFYTWTRDAALTYKVLIDELIAGDTSLEPTIQDYVSAQAKLQAVSNPSGDLS
DGSGLAEPKYHVDLTAFTEAWGRPQRDGPALRATALITYGNYLISKERTSVVKSNIWPIV
QNDLNYVAQYWNQTGFDLWEEVEGSSFFTIAAQHRALVEGSAFAKALGESCEGCDSQAPQ
VLCFQQSFWDGKAIVSNFANNGRTGLDANSVLTSIGNFDPKAPCDDVTFQPCSARALSNH
KLYVDSFRKIYPVNSGKEAGTAVAVGRYSEDTYMGGNPWYLTTLAAAEQLYDALYQWKQL
GSLEITEISLPFFKDLVSSAAAGKYPSSSETYTSITAAVKKYADGFVAVVKEHTPSDGSL
AEQYTRDNGSPASAKDLTWSYAALLSAARREAGTVPPTWGASTANKVPSKCEGSSAKGSY
TTPSVGKW
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgttgacattgaatgttttgacggcactgttggcacctggtgtgttatcatctgccttg
cctgctcgcgatctcaatgcgcgtgccgattcgaagcctgctgctcttcaagccatcctg
aacaacattggcgccgatggatctgctgtttcgggagcatctgcaggcgttgtggtagca
tccccatccaaatcggatcccgattacttttacacctggactcgtgatgcagccttgaca
tacaaggtcttgattgatgagctcattgccggagacacctcgctggaacctaccatccag
gactacgtctctgctcaagcaaagctgcaggccgtgtctaacccgtctggtgacttgtcc
gatggatcaggacttgcagagcccaagtaccacgtggacttgactgccttcacggaggcc
tggggtcgtcctcagcgcgacggacccgctcttcgagccacagcactgattacctatggt
aactatttgatttcgaaggagagaacatccgtcgtcaagtcgaacatctggcccattgtg
caaaatgatctcaactatgttgcgcaatactggaaccaaaccggattcgatctgtgggag
gaggtcgagggctcctcgttctttaccattgctgcacaacaccgcgcattggtggagggc
agcgcatttgccaaggcgctgggagagtcctgcgagggatgcgattcccaggcacctcag
gtcctatgcttccagcagtccttctgggatggcaaggctattgtttctaacttcgccaac
aatggtcgaaccggtctcgatgccaattcggtgcttacctcgatcggaaacttcgacccc
aaggctccctgcgatgacgtgaccttccagccttgctctgctcgtgccctgtcgaaccac
aagctatacgttgactcattccgtaagatctatcctgtgaacagtggtaaggaagctgga
actgccgttgctgttggacgttattccgaagacacttacatgggcggcaacccatggtat
ttgaccaccctggccgcggccgagcagctgtacgatgctctttaccagtggaagcaactg
ggatcgctagaaatcaccgagatcagtcttcctttcttcaaggaccttgtttcgtctgcc
gccgccggaaagtatcccagctcctcggaaacttacacgtccatcactgccgcagtcaaa
aagtatgccgatggatttgtggctgttgttaaggagcacacgcccagcgatgggtctctc
gctgaacaatacactcgggacaacggcagcccggcctctgctaaggacttgacctggtcc
tacgcggcgctcctgtctgctgcccgccgtgaggctggaacagtgccccctacctggggt
gcgtcgactgccaataaggtaccctcaaagtgtgagggtagctcggccaaggggagctac
acgacaccatcagtcggcaagtggtaa

DBGET integrated database retrieval system