KEGG   Penicillium chrysogenum: Pc22g01850Help
Entry
Pc22g01850        CDS       T01091                                 

Definition
glucan 1,4-alpha-glucosidase BAC8255-Penicillium chrysogenum
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
pcs  Penicillium chrysogenum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pc22g01850
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Pc22g01850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 488 aa AA seqDB search
MLTLNVLTALLAPGVLSSALPARDLNARADSKPAALQAILNNIGADGSAVSGASAGVVVA
SPSKSDPDYFYTWTRDAALTYKVLIDELIAGDTSLEPTIQDYVSAQAKLQAVSNPSGDLS
DGSGLAEPKYHVDLTAFTEAWGRPQRDGPALRATALITYGNYLISKERTSVVKSNIWPIV
QNDLNYVAQYWNQTGFDLWEEVEGSSFFTIAAQHRALVEGSAFAKALGESCEGCDSQAPQ
VLCFQQSFWDGKAIVSNFANNGRTGLDANSVLTSIGNFDPKAPCDDVTFQPCSARALSNH
KLYVDSFRKIYPVNSGKEAGTAVAVGRYSEDTYMGGNPWYLTTLAAAEQLYDALYQWKQL
GSLEITEISLPFFKDLVSSAAAGKYPSSSETYTSITAAVKKYADGFVAVVKEHTPSDGSL
AEQYTRDNGSPASAKDLTWSYAALLSAARREAGTVPPTWGASTANKVPSKCEGSSAKGSY
TTPSVGKW
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgttgacattgaatgttttgacggcactgttggcacctggtgtgttatcatctgccttg
cctgctcgcgatctcaatgcgcgtgccgattcgaagcctgctgctcttcaagccatcctg
aacaacattggcgccgatggatctgctgtttcgggagcatctgcaggcgttgtggtagca
tccccatccaaatcggatcccgattacttttacacctggactcgtgatgcagccttgaca
tacaaggtcttgattgatgagctcattgccggagacacctcgctggaacctaccatccag
gactacgtctctgctcaagcaaagctgcaggccgtgtctaacccgtctggtgacttgtcc
gatggatcaggacttgcagagcccaagtaccacgtggacttgactgccttcacggaggcc
tggggtcgtcctcagcgcgacggacccgctcttcgagccacagcactgattacctatggt
aactatttgatttcgaaggagagaacatccgtcgtcaagtcgaacatctggcccattgtg
caaaatgatctcaactatgttgcgcaatactggaaccaaaccggattcgatctgtgggag
gaggtcgagggctcctcgttctttaccattgctgcacaacaccgcgcattggtggagggc
agcgcatttgccaaggcgctgggagagtcctgcgagggatgcgattcccaggcacctcag
gtcctatgcttccagcagtccttctgggatggcaaggctattgtttctaacttcgccaac
aatggtcgaaccggtctcgatgccaattcggtgcttacctcgatcggaaacttcgacccc
aaggctccctgcgatgacgtgaccttccagccttgctctgctcgtgccctgtcgaaccac
aagctatacgttgactcattccgtaagatctatcctgtgaacagtggtaaggaagctgga
actgccgttgctgttggacgttattccgaagacacttacatgggcggcaacccatggtat
ttgaccaccctggccgcggccgagcagctgtacgatgctctttaccagtggaagcaactg
ggatcgctagaaatcaccgagatcagtcttcctttcttcaaggaccttgtttcgtctgcc
gccgccggaaagtatcccagctcctcggaaacttacacgtccatcactgccgcagtcaaa
aagtatgccgatggatttgtggctgttgttaaggagcacacgcccagcgatgggtctctc
gctgaacaatacactcgggacaacggcagcccggcctctgctaaggacttgacctggtcc
tacgcggcgctcctgtctgctgcccgccgtgaggctggaacagtgccccctacctggggt
gcgtcgactgccaataaggtaccctcaaagtgtgagggtagctcggccaaggggagctac
acgacaccatcagtcggcaagtggtaa

DBGET integrated database retrieval system