KEGG   Penicillium chrysogenum: Pc22g03870Help
Entry
Pc22g03870        CDS       T01091                                 

Definition
Pc22g03870
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
pcs  Penicillium chrysogenum
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    Pc22g03870
Enzymes [BR:pcs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Pc22g03870
Protein kinases [BR:pcs01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Pc22g03870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 422 aa AA seqDB search
MADLQGRKVFKVFNQDFIVSEQYNVTKELGQGAYGIVCAATNIQTGEGVAVKKVTNVFSK
KILAKRALREIKLLQHFRGHRNITCLYDMDIPRPDNFNETYLYEELMECDLAAIIRSGQP
LTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSIDPEE
NAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGRPFFKGRDYVDQLNQ
ILHYLGTPNEETLARIGSPRAQEYVRNLPFMPKVAFKQLFPQANPDALDLLDRMLAFDPS
SRISVEEALEHPYLHIWHDASDEPNCPTTFDFHFEVVDEVPEMRKMILDEVIRFRATVRQ
QSQAHAAQQQQIAQQTNIPIPDNHQGPWKTEDPRPQEATAGGGYNPNDLESSLQRGMDVH
HR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggctgatttacaaggtcgcaaggtcttcaaggttttcaaccaggactttatcgtgagc
gagcaatacaatgtgaccaaggagctgggccagggagcctacggtatcgtgtgtgccgca
accaacatccagaccggcgagggcgtcgccgtcaagaaggtcaccaatgtcttcagcaag
aagatcctggccaagcgggccttgcgagagatcaagctgcttcagcatttccgtggccat
cgcaatatcacatgcctgtacgatatggatattccccgaccggacaactttaacgaaaca
tatctctatgaggaattgatggaatgtgatctggctgctatcatccgctccggccagcct
ttgaccgatgcccacttccaatccttcatctaccagatcctctgtggtctcaagtacatc
cactcggccaacgtcctgcaccgtgatctcaaacccggtaacctgctcgtcaatgcagac
tgtgagctcaagatctgtgatttcggcctggctcgtggtttctcaatcgacccggaggag
aacgcgggatacatgaccgaatacgtcgcgaccagatggtaccgtgcaccggagatcatg
ttgagcttccaaagctataccaaagcgattgacgtctggtccgtgggctgtatcctcgcc
gagctcctcggtggccgacccttcttcaagggccgtgactatgtcgaccagctgaatcag
atcctgcactacctgggtacaccaaacgaagagaccctggcgcgcattggatcgccccgc
gcccaggaatatgtgcgcaatctgccattcatgccgaaggtggccttcaagcagctgttc
cctcaagccaaccccgatgcgttggatctgttggaccgtatgctggcgttcgatccatcg
tctcgtatctccgtcgaggaggccctcgagcacccctacctgcacatctggcacgacgct
tcggacgagccaaactgccccaccaccttcgacttccacttcgaggtcgttgatgaagtg
cccgagatgcgcaagatgatcctcgacgaggtcatccgcttccgggctaccgtccgccag
caatcgcaggcccacgccgcccagcagcagcagatcgctcagcagactaacatccccatc
ccggataaccaccagggtccttggaagaccgaggatcctagacctcaggaggctaccgct
ggcggtggttacaaccctaatgacttggaatcctcgctgcagcgcggcatggacgtgcat
caccgttga

DBGET integrated database retrieval system