KEGG   Penicillium chrysogenum: Pc22g03870Help
Entry
Pc22g03870        CDS       T01091                                 

Definition
Pc22g03870
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
pcs  Penicillium chrysogenum
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:pcs04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 422 aa AA seqDB search
MADLQGRKVFKVFNQDFIVSEQYNVTKELGQGAYGIVCAATNIQTGEGVAVKKVTNVFSK
KILAKRALREIKLLQHFRGHRNITCLYDMDIPRPDNFNETYLYEELMECDLAAIIRSGQP
LTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSIDPEE
NAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGRPFFKGRDYVDQLNQ
ILHYLGTPNEETLARIGSPRAQEYVRNLPFMPKVAFKQLFPQANPDALDLLDRMLAFDPS
SRISVEEALEHPYLHIWHDASDEPNCPTTFDFHFEVVDEVPEMRKMILDEVIRFRATVRQ
QSQAHAAQQQQIAQQTNIPIPDNHQGPWKTEDPRPQEATAGGGYNPNDLESSLQRGMDVH
HR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggctgatttacaaggtcgcaaggtcttcaaggttttcaaccaggactttatcgtgagc
gagcaatacaatgtgaccaaggagctgggccagggagcctacggtatcgtgtgtgccgca
accaacatccagaccggcgagggcgtcgccgtcaagaaggtcaccaatgtcttcagcaag
aagatcctggccaagcgggccttgcgagagatcaagctgcttcagcatttccgtggccat
cgcaatatcacatgcctgtacgatatggatattccccgaccggacaactttaacgaaaca
tatctctatgaggaattgatggaatgtgatctggctgctatcatccgctccggccagcct
ttgaccgatgcccacttccaatccttcatctaccagatcctctgtggtctcaagtacatc
cactcggccaacgtcctgcaccgtgatctcaaacccggtaacctgctcgtcaatgcagac
tgtgagctcaagatctgtgatttcggcctggctcgtggtttctcaatcgacccggaggag
aacgcgggatacatgaccgaatacgtcgcgaccagatggtaccgtgcaccggagatcatg
ttgagcttccaaagctataccaaagcgattgacgtctggtccgtgggctgtatcctcgcc
gagctcctcggtggccgacccttcttcaagggccgtgactatgtcgaccagctgaatcag
atcctgcactacctgggtacaccaaacgaagagaccctggcgcgcattggatcgccccgc
gcccaggaatatgtgcgcaatctgccattcatgccgaaggtggccttcaagcagctgttc
cctcaagccaaccccgatgcgttggatctgttggaccgtatgctggcgttcgatccatcg
tctcgtatctccgtcgaggaggccctcgagcacccctacctgcacatctggcacgacgct
tcggacgagccaaactgccccaccaccttcgacttccacttcgaggtcgttgatgaagtg
cccgagatgcgcaagatgatcctcgacgaggtcatccgcttccgggctaccgtccgccag
caatcgcaggcccacgccgcccagcagcagcagatcgctcagcagactaacatccccatc
ccggataaccaccagggtccttggaagaccgaggatcctagacctcaggaggctaccgct
ggcggtggttacaaccctaatgacttggaatcctcgctgcagcgcggcatggacgtgcat
caccgttga

DBGET integrated database retrieval system