KEGG   Penicillium chrysogenum: Pc22g03950Help
Entry
Pc22g03950        CDS       T01091                                 

Definition
Pc22g03950
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.4.19.12]
Organism
pcs  Penicillium chrysogenum
Brite
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Pc22g03950
Peptidases [BR:pcs01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Pc22g03950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1284 aa AA seqDB search
MASVQKAGKTAPRLIHDVQLYDAAHEPDTGRNLLSVTPPIYPEGYNGPPGFISPEACRHN
YVLKEDQTFMSEPEHRRRPGTSSKVSAICAKCRYHLQVVVNYTSHISTFSQKQGKHLHHL
VYQSGRQKNGLALPEVTPKGQVAETYHYQCSYISCSAMVSLRILSPILSPESIRLLTDKD
LLRKRAEEATATYPESMEGMGDPQPINVLDNLRLYITNALRNPQRSKPISSVNKRFMHSF
GVEGAASKELLEFLEFMYNKDTGWHPPKPTTNAEKPYQDTMRLFLDDLLHELLVLIHLRS
VSERKGFQIPNLPSSAIPTISCALEAQDYPEAMRYKEFEMPHAPFYEDLGVMEDMSSSAV
VEAYDRQVLTDPGRTPMYLSALKAIGFLRGGQDKEFIDVAVQAAYEQGKYAVDDVVNAYQ
YFNLHFDDPNLTEDSIIGKFYAFVSSTTQDTEARQQLWRIGDSRGSSRIKAASEDRVSTV
EQANVFLGVENQTPDDFVMTMYTAKVNDNPLTKELAKRAVALIAESRKSVALNHFINTGE
MIAGEMDIGDAYRLLQIPDRTVDDGAIIAAYTICVDENPGDAEKYNQALTIIAKQLDSST
LRNMAGISNEPDRSMQDWPVGLQNIGNTCYLNSLLQFYFSVRPFRELVLDYERFQMDLND
EESLAKKQVGSRKVTKKEVERSQRFLSELRTLFRSMISSSEISVTPGQELARLTLISPSN
EAAIRRRSTITATRPEILGDINGAPILGPLGPPQTLLGGQMEPVSSSSQVDPAPIQNSTV
SDDGSDATLVSDNSMNDAPGLFVEDKENNPPDLDQLSDQAEAGSPQDMNIDTDDTASANV
PPALPPRNVPQVDREKQLKEEVEIGAQQDVTEVINNVLFQSQCAIQPREIGDDGEQLDQV
KDLFYGQTRSYISTEKGTRSKNERWCDIKVDVAHGSRNIYDAIDGAFDIQKISVDNSVAE
QFASISQLPPVLQIQVQRVQFDPVKKCSFKSTNHLGLLETIYMDRYMDTKNPDIVDRRNQ
CWEWKASLKRLEARREELLRTKEGAGVDVATLFRRVKTALQDLDSIENDTETGTGTELES
DSMDAVASTELLDKLECLANKAETDLQAVDREIKDTQTMISSQFADFHQLPYRLYAVFVH
HGSVSFGHYYIYIFDFDKNIWRKYNDEYVTEVQNVDEIFKNDSTNNPPTPYFLVYVNDSM
KDRLANPVCRVISDNMSELPDLEQATTMEGVQPTSPAPDVNMEPPSYEEASAINGTPGTE
NTKSDMENTAWPRPRPATDSEQYW
NT seq 3855 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctgtacagaaggccggaaagaccgcgccgcgtctcattcatgatgtccagctg
tatgatgcagcgcacgaaccagacacaggccgtaatctcctctcagtaactccgcccatt
tacccagaaggctacaacggcccacccggattcatatcaccggaggcatgtcgacacaac
tatgttttgaaagaagaccaaaccttcatgtctgagccagagcaccggagaaggccaggc
acatcatccaaagtctcagccatatgcgcaaagtgccgttatcatctccaagtggtggtc
aactacaccagccacataagcacattcagtcagaaacaggggaaacacttgcatcatttg
gtctaccaatcaggacggcagaagaatggtcttgcgttgcccgaagtaactcctaaaggg
caggttgcggagacgtaccactaccaatgttcctacatttcatgctcggctatggtatct
ttgcggatcctttcaccaattctgagtccggagtccatccgcttgttgaccgataaagac
ttgttgcggaaacgagctgaggaggctactgcaacgtatcctgagtccatggaaggcatg
ggtgatccgcagccgatcaatgtcttggataacctgcgcctgtacattaccaatgcccta
cgaaatccacaacgcagcaagcccatctcctccgtcaataagaggttcatgcattccttc
ggcgtggaaggtgctgcttctaaagaattgcttgaatttctagaattcatgtacaataag
gataccgggtggcacccgcctaaaccgaccactaacgccgaaaagccttaccaagacacg
atgcgtctctttctcgacgacttgctgcatgagttgctagttctgatacatctaagatca
gtctcggaaagaaaaggattccagattcccaatcttccttcatccgccatccccactatt
tcctgcgctctagaagcgcaagactatccggaagctatgcgttacaaggaattcgagatg
cctcatgctcctttttatgaagacttgggagtcatggaggatatgtcctcgtcagctgtg
gtcgaagcatacgatcgacaggtcttaaccgatcctggcaggaccccgatgtacttgtct
gccctcaaggctatcggctttcttcgtggtggtcaggacaaagaattcattgacgtagct
gtccaggcagcttacgaacaaggaaagtacgccgttgatgacgttgtcaacgcgtatcag
tactttaatctccacttcgatgatccaaatctcaccgaagacagcatcattggcaaattc
tatgccttcgtcagctcgacgacacaagatactgaagcgcgtcagcagttgtggcggatt
ggcgactccaggggaagttcgcgcatcaaagcggcatcagaagatcgtgtttctactgtt
gaacaagcgaatgtgttcttgggggtcgagaatcagacccccgatgattttgtcatgact
atgtacaccgcaaaggtcaatgacaatccacttaccaaagaactggcgaagcgcgccgtg
gcactcatcgccgagtcccgaaaatcggtcgcattgaatcatttcatcaatactggagaa
atgatagctggtgaaatggacattggcgatgcgtaccgtctactccaaattcccgatcga
actgtcgatgatggagcaatcatagccgcatatacaatctgcgtcgatgaaaacccaggg
gatgccgaaaaatacaatcaggcactgacaatcattgccaaacaactggacagctcaaca
ttgaggaatatggcaggtatctccaacgagccggatagaagcatgcaagattggccagtc
ggactacaaaacatcggcaacacatgctatctcaacagcctgttgcagttttatttctcc
gtccgtcctttccgtgaattggtcttggattatgaacgcttccaaatggatctcaacgac
gaggaaagcctcgcaaagaaacaagtgggctcgcgaaaggtgacgaagaaggaggttgag
cgatctcagcggttccttagcgagctccggactttgttccgtagcatgatcagctcatca
gaaatctcggttactcccggccaggaacttgctcggttgaccctgattagcccaagcaat
gaggcggcgatacgtcgtcgatcgacgatcactgccactagacccgagatcctcggtgac
atcaacggtgctcctattctgggaccccttgggcctccacagaccctcctcgggggtcaa
atggagccagtctcatcatctagtcaagttgatcccgcacctattcaaaactcaaccgtg
agcgatgacggcagcgatgcaacgttggtttctgataatagcatgaacgatgcacctgga
ctatttgttgaggacaaagagaacaaccccccggacttggaccagctgtcggatcaagca
gaggcaggatctccccaggacatgaatatcgacacagacgacactgcatcggccaacgta
cccccggccctccctcctcggaacgtcccgcaagttgatcgggaaaagcaattgaaggag
gaagtagaaattggtgcccagcaggatgtgacagaagtcatcaacaatgttctgttccag
agccagtgcgccatccagcctcgagaaattggcgatgacggtgagcagcttgaccaggtc
aaggacctgttctacggccagacccgctcttacatctccaccgagaaaggcacacgttcg
aagaacgaacggtggtgtgatatcaaggttgatgttgctcacggatctcgaaacatctac
gatgccattgatggggcatttgatattcaaaagattagtgtggacaactctgtggctgag
caattcgcttccattagccagcttccccctgttctccagatccaggtgcaacgggtccag
tttgatcctgtgaagaaatgctcgttcaaatctacaaaccatctcgggttgcttgaaact
atctacatggatcgatacatggacaccaagaatcccgatattgtggatcgacgaaaccaa
tgctgggagtggaaggcatctctgaagaggctcgaggctcgtcgggaagagcttctcaga
acaaaggagggtgcgggcgtcgacgtggcaacattgttccgtagagtcaagaccgcgcta
caagatctagactctattgaaaacgacaccgagaccggaaccggaaccgaactggaatct
gattcgatggacgccgtggctagtacagagttactggacaaactcgagtgccttgccaat
aaagcagagaccgacctgcaagctgtcgaccgagagatcaaggatacgcagaccatgatt
tccagccaatttgccgatttccatcaactcccataccgactgtacgctgtttttgtgcac
catgggtcagtctcatttggccattactacatctacatcttcgactttgacaagaatata
tggcgcaaatacaacgacgagtacgtcaccgaggtccagaatgtggatgagatcttcaaa
aacgactcgaccaacaaccctccgaccccatacttccttgtttatgtcaacgatagcatg
aaagaccgtctggcaaaccccgtctgccgtgtgatatccgacaacatgtccgaacttccc
gatctggaacaagccaccaccatggagggtgttcaacccaccagccctgcgccggacgtg
aatatggaacctccatcctacgaggaagcgtcggccatcaatggaactccaggtacggaa
aacacaaaatccgacatggagaacacggcatggccccgtcctcgtcctgcgactgactcg
gagcagtattggtag

DBGET integrated database retrieval system