KEGG   Penicillium chrysogenum: Pc22g05070Help
Entry
Pc22g05070        CDS       T01091                                 

Definition
Pc22g05070
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
pcs  Penicillium chrysogenum
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Pc22g05070
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Pc22g05070
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Pc22g05070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 370 aa AA seqDB search
MPELAEIHRIVHFIREHLVGKTLSKVQAQHDDIIFGKVGTSGAEFQKAMQGKKIVGAGQQ
GKYFWMTMSSPPHAVMHFGMAGWLKIKDADTYYYRSDKPADQEWPPKYWKFLLETNDESK
TEAAFVDARRLGRIRLVDCPADEIRDHTPLKENGPDPVTDKDTVDEAWLTEKLGKKKVPI
KALLLDQANISGIGNWMGDEILYHAKIHPEQYSNTLNADQIKDLHSAIHYVCSTSIGVLA
DSEKFPEHWLFKHRWGKGKKNQPAVLPNGDKITFLTVGGRTSAVVPAVQKKTGPVAKDID
GDVTKSTPANSKRKRVALKEESDSEEGEATQTPKRGAPKQKNPIVKSEYFEEEKAKPAVV
GRRRSTRTSK
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagctagcagagatccaccgcattgtgcatttcattcgtgagcacttggttggg
aaaaccctgtccaaagtacaagcacaacatgatgatattatatttggcaaagtcggcacc
agtggtgccgaattccaaaaggcaatgcaaggcaaaaagatagtgggagcaggtcaacaa
gggaaatatttctggatgacaatgtcttcaccaccacacgctgtgatgcactttgggatg
gctggttggttgaagatcaaggatgccgacacatactactatcgatccgacaagcctgca
gatcaggagtggccccctaaatattggaagtttctgctggagacaaatgatgagtcgaaa
acagaggcagcatttgtggatgcccgcagactgggtcgcattaggctggtggattgcccc
gctgatgagatccgagatcatactccgctcaaggagaatgggcctgatccagtcaccgat
aaagacaccgtggatgaagcatggctgacagagaagctgggaaagaagaaagtacccatc
aaggctcttctgctcgaccaggcgaatatcagtggaataggaaactggatgggagatgag
atcctctatcatgccaagatacacccagaacaatacagcaacactttgaatgctgatcag
atcaaggatctacactctgccattcattatgtctgctccacatctattggtgtcttggca
gactcagagaagtttcctgagcactggcttttcaagcatcgctggggcaaggggaagaag
aaccagcccgccgtcctacccaatggggataagatcactttccttaccgttggaggtcga
acaagtgccgttgttccagctgtccagaagaagactggtcctgttgccaaagatattgac
ggagacgttacaaaatccacaccagctaattcgaaacggaaacgtgtggccctgaaggaa
gagagcgactccgaagagggagaagcgacacagactccgaagcgaggagccccaaaacaa
aagaatcccattgtaaagagtgagtactttgaagaggagaaggcgaagcccgccgttgtt
ggcagaagacggtctacccgtacatctaagtga

DBGET integrated database retrieval system