KEGG   Penicillium chrysogenum: Pc22g05160Help
Entry
Pc22g05160        CDS       T01091                                 

Definition
Pc22g05160
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
pcs  Penicillium chrysogenum
Brite
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Pc22g05160
    3.1.1.56  methylumbelliferyl-acetate deacetylase
     Pc22g05160
    3.1.1.84  cocaine esterase
     Pc22g05160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 550 aa AA seqDB search
MALLPKTLASLALVAAVSQAQLWDKVIQTSYGPVQGFQYFNQSILDKYFDGTESNVAAFL
GIPFAADTGYQNRWKPPQPRESWNKVMKATDFGPACPSASASDISEDCLSLNIWTNAQTA
DAKLPVMVWNQGSDETSNNEWWYGGGMALKDVILVTFNRRDDAFGYLATPELNEEGYKLT
GRKTSGNYGVLDQLEVLKWVQKNIAKFGGDPGRVTLAGQSFGSSQVYHAVNSPLFAGYFH
GGISQSGIRYPYDTMLAGLATSYVNMSTAISNGASYMKTHNVSTIEEMRALSMESLLVGS
SDRVTNSSIWWVTALSAGYPLIFKPVLDGYVLPSKYIETLINGPANDVPVITGNTKDESG
ASPNTDYTVEEYEYYCGLKYGNLSSEYFKLYPDHDNDTIASQAWNAAARDLSLVGSWAYA
TDWYKSATADFYTYYWTHAPPSQNQGAFHQSEIMYALGALYANSDRYAFTKTDFEIQEKM
SSYWANFAKTLNPNNGGSYNGSESLPRWSPNSANGTQVVMELGNQFKDVPIAKPKQVEFM
TDYFHQQVPY
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggccctcctgcccaagactctggcctcactggctctggtggctgctgtttcccaagcc
cagctttgggacaaggtcatccaaacttcctacggccccgtccaggggttccagtacttt
aaccaatctatcctggataagtacttcgatggcaccgagtccaacgtcgccgctttctta
gggattcccttcgctgccgatacaggatatcagaaccgatggaagccaccgcagccccgc
gagtcatggaacaaggtcatgaaggcaacagactttggccctgcctgtcctagtgcttca
gcttcagacattagcgaggactgcctcagtctcaacatctggaccaacgctcagaccgct
gatgccaaactccctgtcatggtttggaatcaagggtctgacgaaaccagcaacaatgag
tggtggtacggtggtggcatggccttgaaggatgtcattctcgtcacattcaaccggcgc
gatgatgcattcggctatctcgctacccctgagctcaatgaagaaggctacaagctcact
ggccgcaagacctcaggtaactatggtgttctggatcaactggaagttctcaagtgggtg
cagaagaatattgccaaatttggtggtgatcctggccgcgttactctcgctggtcagtct
ttcggctcttcccaagtctaccatgcagtcaatagccccctcttcgccggctactttcac
ggtggtatctcccagtccgggatcagatacccctacgataccatgctggctggcctcgcc
acctcgtacgtcaacatgtctactgctatctccaatggcgctagctacatgaagacccac
aatgtttctacaattgaggaaatgcgcgcgctctccatggagagcttactggttggttcc
tcagaccgcgtcaccaacagctccatttggtgggttaccgcactctctgccggttatcct
ctgatcttcaagcccgttctggacggctatgtgcttccatccaagtacattgaaaccctg
atcaatggccctgccaacgatgtccccgtgattactggtaacaccaaggacgaatctggt
gcctctcccaacaccgactataccgttgaagagtacgagtactattgtggactcaagtac
ggaaacctctccagcgaatacttcaagctctatcccgaccacgacaacgataccattgcc
tctcaagcctggaacgctgctgcccgtgatctctctcttgtcggatcatgggcctatgcc
actgattggtacaagtctgccactgcggacttctatacgtactattggacccatgcgccc
ccaagtcagaaccaaggagctttccaccaatctgagatcatgtatgcccttggcgctctc
tatgccaattctgataggtacgcctttaccaagaccgactttgagatccaggagaagatg
tcgtcctactgggccaactttgcgaagaccctcaaccccaacaatggcggctcctacaat
ggtagcgaatcgttgccgcgttggagccccaacagtgccaatggtacccaggtggtcatg
gaactcggtaaccagttcaaagatgtgcccattgcgaagccaaaacaggtggagtttatg
acggactacttccaccagcaggttccctactag

DBGET integrated database retrieval system