KEGG   Penicillium chrysogenum: Pc22g06680Help
Entry
Pc22g06680        CDS       T01091                                 

Gene name
facA
Definition
acetate--CoA ligase facA-Penicillium chrysogenum
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pcs  Penicillium chrysogenum
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pc22g06680 (facA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pc22g06680 (facA)
   00620 Pyruvate metabolism
    Pc22g06680 (facA)
   00640 Propanoate metabolism
    Pc22g06680 (facA)
  Energy metabolism
   00680 Methane metabolism
    Pc22g06680 (facA)
Enzymes [BR:pcs01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Pc22g06680 (facA)
Lipid biosynthesis proteins [BR:pcs01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Pc22g06680 (facA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 669 aa AA seqDB search
MSDGPIQPPKPAVVHEAHEVDTFHVPKAFHDKHPSGTHIKDIEEYKKLYEESIKSPDTFW
ARMARELLTFDKDFETTHHGSFENGDNAWFVEGRLNASFNCVDRHALKNPDKVAIIYEAD
EPNEGRKITYGELMREVSRVAWTLKERGVKKGDTVGIYLPMIPEAVIAFLACSRIGAVHS
VVFAGFSSDSLRDRVLDASSKVIITSDEGKRGGKIIGTKKIVDEAMKQCPDVHTVLVYKR
TGAEVPWTAGRDIWWHEEVEKYPNYLAPESVSSEDPLFLLYTSGSTGKPKGVMHTTAGYL
LGAAMTGKYVFDIHDDDRYFCGGDVGWITGHTYVVYAPLLLGCATVVFESTPAYPNFSRY
WDVIDKHDVTQFYVAPTALRLLKRAGDEHIHHKMHSLRILGSVGEPIAAEVWKWYFECVG
KEEAHICDTYWQTETGSHVITPLGGITPTKPGSASLPFFGIEPAIIDPVSGEEIVGNDVE
GVLAFKQPWPSMARTVWGAHKRYMDTYLNVYKGYYFTGDGAGRDHDGYYWIRGRVDDVVN
VSGHRLSTAEIEAALLEHPSVAEAAVVGIADELTGQAVNAFVSLKEGKPTEQISKDLAMQ
VRKSIGPFAAPKAVFVVDDLPKTRSGKIMRRILRKILSGEEDSLGDTSTLSDPSVVDKII
ETVHSARQK
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacggcccaattcagcctcccaagcccgcagtggtgcatgaggcacacgaggtc
gacactttccacgtccccaaggcgttccacgataagcacccctccggcactcacatcaag
gacattgaggagtacaagaagctttacgaagaatcaatcaagagccccgacaccttctgg
gcacgcatggcccgcgagctcctcacatttgacaaggactttgaaaccacacatcacggc
tcgtttgagaacggcgacaatgcctggttcgtcgagggtcggttgaacgcatcgttcaac
tgtgtcgatcgccatgccctcaagaacccagataaggtcgccattatttatgaggccgac
gagcccaacgagggccgtaagatcacctacggagagctgatgcgcgaggtgtcccgggtt
gcctggactctgaaggagcgtggcgtcaagaagggcgacacggtcggtatctacctgccc
atgattcccgaggccgtaatcgctttcctggcttgctcgcgtattggtgccgtgcactcc
gttgtcttcgctggtttctcttccgactccctccgggaccgtgtcctggacgcctcctcc
aaggtcatcattacctccgacgagggcaagcgcggtggcaagatcattggcactaagaag
attgtggacgaggccatgaagcagtgccccgatgtgcacaccgtgctggtgtacaagcgc
accggtgccgaggtgccctggaccgctggccgtgacatttggtggcacgaggaggtcgag
aagtaccccaactacctcgcccctgagtcggtcagctccgaggatcctctcttcctgttg
tacacctccggttccaccggtaagcccaagggtgttatgcacaccactgccggttacctg
ctcggtgcggccatgactggaaagtacgtgtttgatatccacgacgatgatcgctacttc
tgcggtggtgatgtcggttggattacaggtcacacctatgtcgtgtacgcccctctattg
cttggctgcgccaccgtcgtgttcgagagtacccccgcctaccctaacttctcgcgctac
tgggatgtcattgacaagcacgacgtcacacaattctacgttgcacccaccgctctgcgt
ctgctgaagcgcgctggagatgagcacattcaccacaagatgcacagtctgcgtattctt
ggctccgtcggagagcccattgccgcggaagtctggaagtggtacttcgagtgtgttggc
aaggaggaagctcacatctgcgacacatactggcaaaccgagaccggctcacatgtcatc
acccctctcggcggtatcacccccaccaagcccggcagtgcctccctacccttcttcggt
atcgagcctgccattatcgaccccgtctccggagaggagattgtcggcaatgatgtcgag
ggtgttttggccttcaagcagccgtggcccagcatggcccgcaccgtgtggggtgcccac
aagcgttacatggacacttacttgaacgtgtacaagggttactacttcaccggagatggt
gctggccgtgaccacgacggctattactggatccgcggtcgtgttgacgatgtcgtcaac
gtttctggacaccgtctgtccaccgctgagatcgaggccgctcttctcgagcacccttcc
gttgccgaggctgctgtcgttggtattgccgacgagctgaccggtcaggctgtcaatgcc
tttgtctctctcaaggagggcaagcccacagaacagatcagcaaggaccttgcaatgcaa
gttcgcaagtccattggtcccttcgccgcccccaaggctgtcttcgtcgtggatgacctc
cccaagacccgcagtggcaagatcatgcgccgaatcctccggaagattctcagtggcgag
gaggacagcctcggtgatacatcaacgctctccgaccccagtgtcgtggacaagatcata
gaaaccgtccacagtgctcgccagaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system