KEGG   Penicillium chrysogenum: Pc22g06680Help
Entry
Pc22g06680        CDS       T01091                                 

Gene name
facA
Definition
acetate--CoA ligase facA-Penicillium chrysogenum
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pcs  Penicillium chrysogenum
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pcs01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pcs00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pcs00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pcs00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:pcs00680]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 669 aa AA seqDB search
MSDGPIQPPKPAVVHEAHEVDTFHVPKAFHDKHPSGTHIKDIEEYKKLYEESIKSPDTFW
ARMARELLTFDKDFETTHHGSFENGDNAWFVEGRLNASFNCVDRHALKNPDKVAIIYEAD
EPNEGRKITYGELMREVSRVAWTLKERGVKKGDTVGIYLPMIPEAVIAFLACSRIGAVHS
VVFAGFSSDSLRDRVLDASSKVIITSDEGKRGGKIIGTKKIVDEAMKQCPDVHTVLVYKR
TGAEVPWTAGRDIWWHEEVEKYPNYLAPESVSSEDPLFLLYTSGSTGKPKGVMHTTAGYL
LGAAMTGKYVFDIHDDDRYFCGGDVGWITGHTYVVYAPLLLGCATVVFESTPAYPNFSRY
WDVIDKHDVTQFYVAPTALRLLKRAGDEHIHHKMHSLRILGSVGEPIAAEVWKWYFECVG
KEEAHICDTYWQTETGSHVITPLGGITPTKPGSASLPFFGIEPAIIDPVSGEEIVGNDVE
GVLAFKQPWPSMARTVWGAHKRYMDTYLNVYKGYYFTGDGAGRDHDGYYWIRGRVDDVVN
VSGHRLSTAEIEAALLEHPSVAEAAVVGIADELTGQAVNAFVSLKEGKPTEQISKDLAMQ
VRKSIGPFAAPKAVFVVDDLPKTRSGKIMRRILRKILSGEEDSLGDTSTLSDPSVVDKII
ETVHSARQK
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacggcccaattcagcctcccaagcccgcagtggtgcatgaggcacacgaggtc
gacactttccacgtccccaaggcgttccacgataagcacccctccggcactcacatcaag
gacattgaggagtacaagaagctttacgaagaatcaatcaagagccccgacaccttctgg
gcacgcatggcccgcgagctcctcacatttgacaaggactttgaaaccacacatcacggc
tcgtttgagaacggcgacaatgcctggttcgtcgagggtcggttgaacgcatcgttcaac
tgtgtcgatcgccatgccctcaagaacccagataaggtcgccattatttatgaggccgac
gagcccaacgagggccgtaagatcacctacggagagctgatgcgcgaggtgtcccgggtt
gcctggactctgaaggagcgtggcgtcaagaagggcgacacggtcggtatctacctgccc
atgattcccgaggccgtaatcgctttcctggcttgctcgcgtattggtgccgtgcactcc
gttgtcttcgctggtttctcttccgactccctccgggaccgtgtcctggacgcctcctcc
aaggtcatcattacctccgacgagggcaagcgcggtggcaagatcattggcactaagaag
attgtggacgaggccatgaagcagtgccccgatgtgcacaccgtgctggtgtacaagcgc
accggtgccgaggtgccctggaccgctggccgtgacatttggtggcacgaggaggtcgag
aagtaccccaactacctcgcccctgagtcggtcagctccgaggatcctctcttcctgttg
tacacctccggttccaccggtaagcccaagggtgttatgcacaccactgccggttacctg
ctcggtgcggccatgactggaaagtacgtgtttgatatccacgacgatgatcgctacttc
tgcggtggtgatgtcggttggattacaggtcacacctatgtcgtgtacgcccctctattg
cttggctgcgccaccgtcgtgttcgagagtacccccgcctaccctaacttctcgcgctac
tgggatgtcattgacaagcacgacgtcacacaattctacgttgcacccaccgctctgcgt
ctgctgaagcgcgctggagatgagcacattcaccacaagatgcacagtctgcgtattctt
ggctccgtcggagagcccattgccgcggaagtctggaagtggtacttcgagtgtgttggc
aaggaggaagctcacatctgcgacacatactggcaaaccgagaccggctcacatgtcatc
acccctctcggcggtatcacccccaccaagcccggcagtgcctccctacccttcttcggt
atcgagcctgccattatcgaccccgtctccggagaggagattgtcggcaatgatgtcgag
ggtgttttggccttcaagcagccgtggcccagcatggcccgcaccgtgtggggtgcccac
aagcgttacatggacacttacttgaacgtgtacaagggttactacttcaccggagatggt
gctggccgtgaccacgacggctattactggatccgcggtcgtgttgacgatgtcgtcaac
gtttctggacaccgtctgtccaccgctgagatcgaggccgctcttctcgagcacccttcc
gttgccgaggctgctgtcgttggtattgccgacgagctgaccggtcaggctgtcaatgcc
tttgtctctctcaaggagggcaagcccacagaacagatcagcaaggaccttgcaatgcaa
gttcgcaagtccattggtcccttcgccgcccccaaggctgtcttcgtcgtggatgacctc
cccaagacccgcagtggcaagatcatgcgccgaatcctccggaagattctcagtggcgag
gaggacagcctcggtgatacatcaacgctctccgaccccagtgtcgtggacaagatcata
gaaaccgtccacagtgctcgccagaagtaa

DBGET integrated database retrieval system