KEGG   Penicillium chrysogenum: Pc22g08740Help
Entry
Pc22g08740        CDS       T01091                                 

Definition
Pc22g08740
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
pcs  Penicillium chrysogenum
Brite
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Pc22g08740
Peptidases [BR:pcs01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   Pc22g08740
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 249 aa AA seqDB search
MAHVDVPETQKAFVPLENNPEVMSHLVHQLGLAPTLGFTDVFSIDEPDLLAFVPRPSQAL
LLVFPVSQTYEASREAEDASKQNYTGSGPSEPVMWFKQTIRNACGLIGLLHAVSNGEARK
HVVAGSDLDTLLREAEGLEPVPRADLLYDSKALESAHADAAKLGDTAAPEAEDNVDLHFV
AFVRGLDGTLWELDGRRKGPLARGVLKEGEDALSEAALELGVRRFLKMEAQGGNPDLRFS
LVSLGPLFD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcacacgtcgatgtcccagaaacccaaaaggcctttgtgccactagaaaacaacccg
gaagtaatgtcccacctagtgcaccaactaggcctggccccaaccctaggcttcacagac
gtattctcgatcgacgagccggacctcctagccttcgtcccacgcccctcccaagccctc
ctcctcgtcttccccgtctcccaaacctacgaagcctcccgcgaagccgaagacgcctcc
aaacaaaactacaccggctccgggccctccgaacccgtaatgtggttcaagcaaaccatc
cggaacgcatgcgggctaatcgggctgctgcacgcggtctcgaatggcgaagcccggaaa
catgtcgtcgccggctcggatttggatacgttgctccgtgaggcggagggactggagcct
gtgccgcgcgcggatctgctgtatgatagtaaggcgctggagagtgcgcatgctgatgcg
gcgaaattgggggatacggctgcgccggaggcggaggataatgttgatttgcactttgtt
gcttttgtgagggggcttgatgggacgctttgggagttggatgggaggaggaaggggccg
ctggctaggggggttttgaaggagggggaggatgcgcttagtgaggcggcgttggagttg
ggggttaggagatttttgaagatggaggctcagggcgggaatccggatttgaggtttagt
ttggttagtttggggcctttgtttgattag

DBGET integrated database retrieval system