KEGG   Penicillium chrysogenum: Pc22g09070Help
Entry
Pc22g09070        CDS       T01091                                 

Definition
Pc22g09070
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
pcs  Penicillium chrysogenum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 490 aa AA seqDB search
IGVKAMVQKDGELRKAEILSIRQRKDGPSFYVHYVDFNKRLDEWVASSRIDLSQEVEWPQ
PDKADKKKTAAASKAAPSKNVGANKRARADSRDTSQTPDILGGKNVNVGKLARPSKAGGK
ENLGVETPGGDTSLFPSEAASTVATPKPTESEDFEMADAPAESKSVKEDHVQMATGEVIT
RGEEIERLRTGGSMTQNPTEIHRVRNLTRLQMGKYDVEPWYFSPYPDSFSDVDLVYIDEF
CLSYFDNKRAFERHRAKCTLTHPPGNEIYRDDYISFFEVDGRRQRTWCRNLCLLSKLFLD
HKTLYYDVDPFLFYCMTTRDETGCHFVGYFSKEKDSAEGYNLACIMTLPQYQRRGFGRLL
ISFSYELSKREGKLGSPEKPLSDLGLLGYRQYWRETLVELLIEPNREAISENELAVLTSM
TEKDVHETLVVFNMLRYHKGNWVIVLTDQVVEEHEKRLKKEEIKGARKIDPARLQWKPPV
FAASSRTWNW
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atcggtgtgaaggccatggtgcagaaggatggagaattgcgaaaagctgagattctgtct
attagacagcggaaggatggtccttccttttacgtacactatgttgatttcaacaagcgt
ctcgatgaatgggttgcgtcttctcgcatcgatctctcccaggaagtcgaatggccccag
ccagacaaggctgacaagaaaaagaccgccgccgccagcaaagcggctcccagcaagaat
gtgggtgcgaataagcgtgcccgggctgacagccgtgatacgtcacaaacacctgatatc
ctgggcggcaagaacgtgaacgtcggcaaattggcacggccctcgaaagctggagggaaa
gagaaccttggtgtcgagacacctggaggagacacctcgctgttcccgtctgaggctgca
tcaacagtggccacgccgaagcccaccgagtcagaagacttcgagatggcagatgctcca
gcggaaagcaaatcggtaaaagaagaccatgtccaaatggcaaccggtgaggtgatcact
cgcggggaggaaatcgagcgactccgcacaggtggtagtatgacacagaacccgacagag
atccatcgtgtacgaaacttgacccgcctccagatgggcaagtacgacgtcgagccgtgg
tacttctccccgtacccggattccttctcggacgtcgacttagtctacatcgacgagttc
tgcctcagctacttcgacaacaagcgtgcgttcgagcgtcatcgcgcaaaatgcaccttg
acccacccacctggtaatgagatctaccgtgacgactacatctccttctttgaagtcgac
ggccgtcgccagcgtacctggtgccggaatctgtgtctcctgagtaagctcttcctcgat
cacaagacgctttactacgacgtcgacccgttcttgttctactgcatgaccacacgcgac
gagaccggctgccatttcgttggctacttctccaaggagaaggactctgctgaagggtac
aacctggcgtgtattatgactttaccgcaataccagcgccgcggtttcggccgtctgctc
atctcgttcagctacgagctcagcaagcgcgaaggcaagctcggctctcctgagaagcca
ctcagtgatctcggtctacttggttatcgacagtactggcgcgagacactagtggagtta
ctgattgagccaaatcgagaagctataagcgagaacgagctcgcggtgctcacctccatg
actgagaaggatgttcacgagactcttgttgtattcaacatgctccgataccacaagggt
aactgggtcattgtactcacggaccaagtcgtggaagaacacgaaaagcgtctcaagaag
gaggagatcaaaggcgcgcgcaaaatcgatcctgcccgtcttcagtggaagcctcctgtc
tttgctgcttccagccggacctggaactggtga

DBGET integrated database retrieval system