KEGG   Penicillium chrysogenum: Pc22g10060Help
Entry
Pc22g10060        CDS       T01091                                 

Definition
Pc22g10060
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pcs  Penicillium chrysogenum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Pc22g10060
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Pc22g10060
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Pc22g10060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 908 aa AA seqDB search
MGQLFMMGFDGTSVNPQIRSLIENYHLGAVLLSAKNLKSAEDTTRLVLELQTIARDAGHP
VPLLIAMDQENGGVNSLYDEIYIRQFPSTMGIAATGSKSLAHDVAVATAQELKAVGVNWI
LGPVLDVLTNVRNQPLGVRTAGDDPQEASRYGVQFMKGYQEAGLVTCGKHFPSYGNLEFL
GSQTDVPIITESLEQLSLSALVPFRNAISQGLDAMMVGGVSLSSAGMNVMHACLSDQVVD
ELLRKDLQFQGVVVSECLEMEALTHNIGVGGGTVMAKNAGCDVILLCRSFPVQQEAINGL
KLGVENGIIGRQRIEQSLRRVLDLKARCTSWEQALNPPGLSSLTQMQPSHTNLSTRAYNS
SITVMRDKNNLLPLSNVIEADEELLLLTPLVKPLPTSAVSLSVTESAHALSSERTSSVLS
GEGVFKELGRSLSRQRNGRVLHTSYTSNGVRPIHEDLIQRASAVVVVTADANRNLYQQGF
SKHVSMICQSQYNSSGERRERPLIVVAVSSPYDFAMDSSIGTYICTYDFTETALQALVKV
LYGDLTPSAALPGSIGRTQKIHQSRQHWLVENWNEDRDAFALDALLDTVRADYALGQPSE
LLGATSSSFLLRKEDVDEAHFVVRNSSTHALYGFCATYFFRSTGTGVLACLIVDPSRRKL
SIGHSLHSRAIRTLLQRSGMRRFQLGSRLPGIYLGIPTVNPVERKRLRQWFANMGWNTAL
SRPVCSVILRNLSTWVPPEGLTATLQSAEVSYDLVYGWDFAPAILDHIKTYARQGVADIY
RMALGDAPNCGIIRAKRPSDGVILGSVVIYNVRSALAEHMPVLRATQASVGGISSPVISP
CGEDYSAVMQGLILLAIKQIRKLSADAVVMDCVDGDGNFDHLSTMGFTMLHSFEEVNCDA
ATWTMMHA
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atgggccagctctttatgatgggctttgatggaacttcggtcaacccacagattcgatca
cttattgagaattaccacttgggcgcggtgctgctatctgcgaaaaatctgaaatcggcc
gaggatacaaccagattggtcttggaattacagaccattgcgcgtgatgcaggccatccc
gtcccgttactaattgccatggaccaggagaatggtggtgtcaacagtttatacgatgaa
atatatattcgccaatttcctagtaccatgggcatcgcagccactgggtccaaatcttta
gcccacgatgtggctgtcgcgacagcacaggaactcaaggcagttggggtcaattggatc
ttagggcccgttttggatgttttgaccaatgtgcgaaaccaaccattaggcgttcgtacc
gctggcgatgatccccaagaggcgtctcgatatggcgtccagttcatgaaggggtaccaa
gaagcaggtttagtgacttgtggaaaacacttcccatcttatggtaacttggaatttctc
ggttcccagacggatgtcccaattattacggaatccctggaacaactcagtctcagcgca
cttgtaccctttcgcaacgctataagtcaaggcctagatgccatgatggtgggaggtgtc
tcattatcatcagctggcatgaacgtgatgcacgcctgtctgagtgatcaggtggttgac
gagctgttgagaaaggatctccaatttcaaggggtggtcgtttccgaatgcttggaaatg
gaggcgctcacacataacattggagtaggaggtggcacggtaatggcgaagaacgccggc
tgcgatgtcatccttttatgtcgttcattcccggtccaacaagaagccatcaacggcttg
aaactcggagtggagaacggtatcatcggccgtcagcgaattgaacaatcgttgcgccgc
gttttggatttgaaggcacggtgtacttcgtgggaacaggcactgaaccctccggggctt
tcttcacttacacagatgcaaccctcgcataccaacctttccacccgagcctacaattct
tccatcacagtgatgagagataagaataatttacttccgttgtctaatgtcatcgaggca
gacgaagaacttttgcttctgactccgctagtcaagccactcccaacatcagcagtttct
ctttcggtcacagagtctgcgcatgcattatcttcagaacgaacctcgtcggttttgagt
ggagagggtgtcttcaaagaacttggacgatcactgtcgcggcagaggaacgggcgcgtg
ctgcacacctcctatacttccaatggtgtgcgtcccatccacgaagacctcattcaaaga
gcgagtgctgtagtcgttgtcacggcagatgcgaatcgcaatctatatcagcaagggttc
tcgaaacatgtctccatgatctgtcaatcacagtataactcatctggtgaacgccgcgag
aggccattaattgtggtggcagttagctcgccgtatgattttgccatggattcctcaatt
ggtacttatatatgcacgtatgacttcaccgaaacagctctccaagcattggtcaaggtc
ttgtatggcgacttgacaccctcagcggcccttcccggctccattggtcgaacgcagaag
atccaccagtctcgacagcactggcttgtcgaaaattggaacgaggatcgcgacgctttc
gccttggatgctttgctcgataccgtccgtgccgactatgcactgggccagccgtcggaa
cttcttggagctaccagtagcagcttcttgctacgaaaggaggatgtcgacgaagcccat
tttgttgtccggaacagtagcacacatgccctctatgggttctgcgcgacctacttcttt
cgatcaacaggcaccggcgtgcttgcctgtctgattgtggacccttctcgaaggaaacta
tcaatcggacattcactccacagccgcgcgattcggactctacttcagcggagcgggatg
agacgcttccagttaggatcccgattaccaggaatctaccttggcatcccgactgtcaac
cctgtggagcgtaagcggctgcggcaatggttcgcgaatatggggtggaacaccgccctt
tcccgaccagtgtgcagcgtgatcctgcgcaacctgtcgacatgggtgccgcccgaaggt
ctcactgcgacgctgcagagtgccgaggtctcatacgacctcgtgtatggctgggatttt
gcgccggcgatcctcgaccacattaaaacatatgcgcggcaaggcgtggccgacatatac
cgcatggctctgggcgatgcgcctaattgcgggatcattcgggccaagcggccctctgac
ggggtcatactcgggagtgtcgtgatttacaatgtgcgatctgccttggcagagcacatg
cccgtgctgcgcgccacgcaggcttctgtcggaggcatttcatctccggtcatttcccct
tgcggtgaagattactccgcggttatgcagggccttatcctgctagctatcaagcagatc
cggaagttaagcgccgatgctgtggttatggattgtgtcgacggcgacggtaacttcgac
catctctccacgatgggcttcactatgctgcacagcttcgaggaagtgaactgtgacgca
gctacatggacgatgatgcatgcgtag

DBGET integrated database retrieval system