KEGG   Penicillium chrysogenum: Pc22g13300Help
Entry
Pc22g13300        CDS       T01091                                 

Definition
Pc22g13300
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
pcs  Penicillium chrysogenum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pcs00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 600 aa AA seqDB search
MLLPCVSRAVRPRRTQLIHLNDQKRAYTAAVLGGGITGLTAAWQLAQDPTCKQVILFEKT
DRLGGWINSETVPVDGGNVVFEYGPRTLKSSLPGSLPLLYLATNLGLYDDLIVTPNTSPA
ARNRYIYYPDRLVRMPAPKPELSFGENLQIFMDTMQEPLFNKFLSGIAKDVFTPPRHPTE
WAKDESVADFIRRRFGPNVADNLVSAVYHGIYAGDIDRLSAQALLGSIRNLEGGIGGIGG
LVSGGVTASLISRSISKTRTRNMDDFMAIDAMPAGPELVRRQHDLEVLAAGASTFTFKRG
VGQLIQALIASLKASGKVDLRLNTEIKALSKESTAAIAMEYWSHRHNQIKTFDYRYVIST
IPPVSLANIMRKPEQSHAEMIPVGLTPSLLRKQNYAVTVMVVNLYYPNPNLLPVEDGFGY
LIPRSIPYKQNPECGLGVIFASSSISQDSAPGTKLTVMLGGHYWDGFEEYPDHDTAVKMA
RDMLKRHMNITDTPTVARSRLQKDAIPQYTVGHLDRMYKLSHTVRKEYSKRLILAGNWYN
GVSVGDCVKQGILSATYGIGRIPLNDEPSPWRPWTSFDYERWNLRGGIVTSPVRLVDSEI
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgttgctaccatgtgtctctagagcagtaagaccaagacgaacgcaattgattcatctc
aatgatcagaaacgcgcatacactgccgccgttcttggtggtggcatcactggactcaca
gccgcctggcaactcgcgcaagaccctacatgcaaacaggtcatcttgttcgagaaaacg
gaccggctcggtggttggataaattctgaaacagttcctgttgatggtggcaatgtcgtg
tttgagtatgggccgcggaccttaaagagctcgctgccaggatcactccctctgctttac
ctggctacaaatctaggcttgtacgacgacctcattgttacccccaacacgagccccgcg
gcccgaaatcgttacatttactacccggaccgtctcgttcgtatgccggcgccaaagcct
gaactctcttttggggaaaacttgcaaatctttatggatactatgcaagagccgctattt
aacaaatttctctcggggatagcgaaggatgtcttcactccgccccggcacccaaccgaa
tgggcgaaggatgaatctgttgccgacttcatcagacgtcgttttggccccaatgttgca
gataatctagtctctgctgtgtaccatggaatctatgctggtgatatcgatcgattgagt
gcccaagcactattgggtagcattcgcaaccttgagggaggcattgggggcatcggtggg
ttggtttctggtggagttacggcatctcttatctccaggtcaatctctaaaacgagaact
cggaatatggatgatttcatggccatagacgccatgcccgcaggccccgaattagtgcgc
cgtcagcatgatttagaagtccttgcggctggagctagtaccttcacctttaagagggga
gtcggccagcttattcaagcactgattgcttcattgaaagcatccggcaaagtcgacctc
cgattgaacacagagatcaaagctttgagtaaagagtctactgctgccattgctatggaa
tattggtcacacaggcacaatcaaatcaagacatttgactatcgatatgtcatctccact
atccctccagtttcacttgcgaacatcatgcgcaaacccgaacagtcacatgccgagatg
atccccgtcggcttaaccccatctctattacgcaaacagaactacgccgtgacggtaatg
gtcgttaatctctattacccaaatcccaaccttctacccgtggaggatggctttggatac
ctcataccgcgttcgatcccctacaagcagaacccagaatgtggacttggtgtcatcttc
gcctcgtcctctatcagccaagattctgcacctggaacgaaactcaccgtcatgctaggt
ggacattactgggatggtttcgaagagtatccagaccacgacactgcagtgaaaatggcc
cgcgacatgctcaagagacacatgaatatcaccgatactccgactgtcgcgcggagtcgt
ctccagaaggatgctattcctcagtacacagtcggccatctggaccgtatgtataagctc
tcgcacacagttcgcaaggagtacagcaagcggctcattctcgcgggaaactggtataat
ggcgtaagtgtgggcgactgtgtcaaacagggtatcctatctgccacctacggcattgga
agaatcccgctcaatgatgagcctagtccgtggcgtccatggacttcctttgattatgaa
cgttggaacctccggggtggcattgtgacgtctcctgttcgtcttgttgactccgaaatc
tga

DBGET integrated database retrieval system