KEGG   Penicillium chrysogenum: Pc22g13330Help
Entry
Pc22g13330        CDS       T01091                                 

Definition
Pc22g13330
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pcs  Penicillium chrysogenum
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Pc22g13330
Enzymes [BR:pcs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Pc22g13330
Exosome [BR:pcs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pc22g13330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 624 aa AA seqDB search
MQPSDTFVGSIDQGTTSTRFLIFNRDGDPVASHQVEFSQIYPNPGWHEHDPLEIVTSVET
CIEEAVRNFETQGHTRSSIQSVGITNQRETTIVWDHETGEPLYNAIVWTDTRSQAIVAEL
KQKPGAAQLQTLCGLPLSTYSSATKLLWMLAHVPRVKDAFDRGTLAFGTVDAWLVYRLNG
GVAANVFVSDSTNASRTMFVNLETLQYDQTLLDFFGIRGKVHLPRIVPSSDATAYGVVAS
GALARVPIMGCLGDQSAALVGQKGFSPGMAKNTYGTGCFLLYNVGDKPVFSTHGLLATVA
YHFGGKPIYAQEGSIAVAGSGIKFLQNNLNFFQESKEVNELAYSVEDSGGCVFVTAFSGL
FAPYWIDDAKGTIFGITQYTQKGHIARATLEATCFQTKAILDAMEKDSGHALSELAVDGG
MSNSDLAMQTQADLISIPVYRPKMRETTALGAAIAAGLAAGLWHNFAELRDINRSGGVVF
EPQVPRQESVAKFGQWEKAVQMSRGWVGSKSTEQKEQKEVASPKNGTYAPAKDSGLPPSK
GLQISDTSLISDVVKSSTYIAAVKERAHVSVKEIEATYPTVRTGLGSVLCDLDDADEEDL
FMELRKVEILQRLRKLRKRQSNSY
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgcagccctcagatacctttgtgggatcgatcgatcaaggcacaacgagcaccaggttt
ttgatcttcaaccgcgacggcgacccagtagcatcacatcaagtcgagttcagccaaatc
tacccgaacccgggttggcacgagcatgaccctctcgagatcgtaacctcagtagagacc
tgcatcgaggaagccgtccggaacttcgaaacacaaggccacacccgaagcagcatccag
agcgtcggaataaccaaccagcgcgaaacaaccatagtctgggaccacgagaccggcgag
cccctgtacaatgccattgtatggacagacacacgctcccaggcgatcgttgcagaactg
aaacagaaaccaggggctgcgcagctccagactctctgcggtctgccgctgtcaacctac
tcgtcggctacgaagctgctctggatgttggcgcatgtccccagagtgaaggatgcattt
gaccgcggcacgctggcgtttggtaccgtcgatgcttggctggtctaccgtttgaacggt
ggcgtggctgccaacgtctttgtctcggattcgacaaacgcttcgcggaccatgtttgtg
aacctggagacgttgcagtacgatcagacgcttctggacttttttgggattagggggaag
gttcatttgcctaggattgtgccctcgtctgatgcgacggcgtatggggttgttgcttct
ggggcgttggcacgggttccgattatgggatgtctgggtgatcagtctgcggcgttggtt
gggcagaaagggttctcgcctggaatggcgaaaaacacttatggcactggttgctttctt
ctgtacaatgttggtgacaagcccgtgttctcgacacatggattactggctacggtggct
taccactttggtgggaagcctatctatgcacaggagggaagcattgctgtagctgggtct
gggatcaaattcttgcagaacaacttgaatttcttccaggagtctaaggaggtcaatgaa
cttgcctactcggtggaagacagtggtggatgtgtatttgtcactgccttcagtggactt
ttcgcaccttattggattgatgacgcaaaaggtacaatctttgggatcacccaatacacc
caaaagggccatatcgcacgtgctactctagaggcaacctgcttccagactaaagccatc
ctagacgcaatggagaaagacagcggccatgcactctccgaactggctgtagatgggggt
atgagcaactcagacttggcaatgcagactcaagcagacctgatatctatcccggtctac
cgccccaagatgcgtgaaactacagctctcggcgcagcaattgcagcaggccttgctgct
ggactgtggcacaactttgccgagctacgcgacatcaatcgttctggcggtgtggtcttc
gagccccaagtcccgcgacaagagagtgttgctaaattcggacaatgggaaaaggctgtg
cagatgagtagaggctgggtgggatctaagagcacagagcaaaaagagcaaaaagaggtc
gctagtcccaaaaacggcacatatgcaccggcgaaggattctggtctacctccgtctaaa
ggattgcagatctcggatacttctttgatctcagatgtggttaaaagctcaacatacatt
gccgctgtcaaagagagagctcatgtctcagtaaaggagatcgaagccacatacccaact
gtacggacgggtctggggagtgtgctatgtgatttggatgatgcagatgaagaggatttg
ttcatggagctgcggaaagtggagattttgcaaagactgaggaagctacggaagcgacag
tcaaactcctactaa

DBGET integrated database retrieval system