KEGG   Penicillium rubens: Pc22g13470Help
Entry
Pc22g13470        CDS       T01091                                 

Definition
(RefSeq) Pc22g13470
  KO
K01694  tryptophan synthase [EC:4.2.1.20]
Organism
pcs  Penicillium rubens
Pathway
pcs00260  Glycine, serine and threonine metabolism
pcs00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pcs01100  Metabolic pathways
pcs01110  Biosynthesis of secondary metabolites
pcs01130  Biosynthesis of antibiotics
pcs01230  Biosynthesis of amino acids
Module
pcs_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pc22g13470
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pc22g13470
Enzymes [BR:pcs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pc22g13470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trp_syntA PALP
Motif
Other DBs
NCBI-GeneID: 8311258
NCBI-ProteinID: XP_002565273
UniProt: B6HT75
AA seq 723 aa AA seqDB search
MEAIKQTFAKCKEQKRAALVAYITAGYPTVEEAVDILLGLENGGADIIELGIPFTDPIAD
GPTIQTANTKALQNGVTLTTVLELVRTARSRGLQTPLMLMGYFNPVLKYGEERMLRDCKE
AGVNGFIMVDLPPEEAVRFRDLCSSAGLSYIPLIAPATSDARMRLLCKIADSFIYVVSRM
GVTGATGSLSANIPELLNRVHEYSGNVPAALGFGVSTREHFLSVQEQAEGVVIGSQIITC
VGKAPAGQAAKAAEEYLSSITGRKRERDATGAFTREINVLEAVEKALPSSQVQPTKVITD
ADTPAGPGLADQIEALNVTKDASSQPSRFGEFGGQYVPESLMDCLSELERGFDVANNDPK
FWEEFRSYYPYMGRPSSLHLAQRLTEHVGGANIWLKREDLNHTGSHKINNALGQILIARR
LGKTRIIAETGAGQHGVATATVCAKFGMKCTVFMGAEDVRRQGLNVFRMKLLGASVVAVE
AGSRTLRDAVNEALRAWVVELDTTHYIIGSAIGPHPFPTIVRTFQSVIGNETKEQMQAQI
GKLPDAVIACVGGGSNAVGMFHPFSNDPSVKLIGVEAAGDGVDTNRHSATLSGGSHGVLH
GVRTYVLQNEHGQISDTHSISAGLDYPGVGPELSNWKDSNRATFIAADDSQALAGFRALA
QHEGIIPALESSHAVWGVMQIAKTMEKGQNIVLNLSGRGDKDVQQVADELPRLGPKIDWD
LRF
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggaagctatcaagcagactttcgccaagtgcaaggagcagaagcgcgcggcccttgtg
gcatacattactgcaggataccccactgttgaggaggcagttgatatcctccttggtctc
gagaacggcggagccgatatcatcgagcttggaatcccctttacagaccccatcgctgat
ggtcccactattcagaccgctaacacaaaggcgcttcagaatggtgtcaccctcactact
gtgcttgagcttgtccgcactgcccgcagccgcggtctgcagactcctttgatgctcatg
ggttacttcaaccccgtccttaagtatggtgaggagcgtatgctccgtgactgcaaggag
gctggtgtcaatggcttcatcatggttgacttgcccccggaggaggctgtccgtttccgc
gacctctgctcgagcgctggtctctcatacatcccgcttatcgcccctgctacctccgat
gcccgcatgcgtctcctctgcaagatcgcagacagctttatctacgttgtttcccgcatg
ggcgtgaccggtgccaccggctcattgagcgcaaacattcccgagcttttgaaccgcgtc
cacgaatattcaggcaatgtccctgctgcattgggattcggtgtcagcacccgtgagcac
ttcctgtccgtccaggagcaggccgagggtgtggtcattggcagccagattatcacttgc
gttggcaaggcccctgctggccaggctgccaaggctgccgaagagtacctctccagcatt
accggacgtaaacgtgagcgtgatgccaccggtgcctttacccgcgagatcaacgtcctt
gaggccgttgagaaggccctgccttctagtcaggtccagccgactaaggtcatcaccgat
gccgatacccccgccggacctggtcttgctgaccagattgaggccctcaacgtcacaaag
gatgcatcttcccagccctcgcgcttcggtgagttcggtggacagtatgtccccgagtcc
cttatggattgcttgagtgagctcgagcgcggctttgatgtcgccaacaacgaccccaag
ttctgggaagaattccgctcatactacccctacatgggccgccctagcagccttcacttg
gcccagcgtttgacagagcacgttggcggcgccaacatctggttgaagcgtgaggacctg
aaccatactggtagccacaaaatcaacaatgctcttggacagattttgattgcccgtcgc
ctgggcaagacccgcatcattgccgagaccggtgctggccagcacggtgttgctactgcc
acagtttgcgccaagtttggcatgaagtgtaccgtcttcatgggtgccgaggatgtgcgt
cgccagggtctcaatgtcttccgcatgaagctccttggtgcttccgttgttgctgtcgag
gctggaagccgcaccctccgtgatgcagtcaacgaggctctccgcgcctgggtcgtcgaa
cttgataccacccactacatcattggctctgctattggcccccacccgttcccgaccatc
gtccgtactttccagtctgtcattggaaacgagaccaaggagcaaatgcaggcacagatt
ggcaagctccccgatgctgtcatcgcctgtgttggcggcggtagcaacgcagtcggaatg
ttccaccccttctccaacgatcccagtgtgaagctcatcggtgttgaggctgcgggagac
ggcgttgataccaaccgccactctgccaccctctctggtggttcccacggcgtcctccac
ggtgtccggacatacgtcctgcagaacgagcacggtcagatctccgacacccactcgatc
tctgctggtctggattaccccggtgtcggccccgagctgagcaactggaaggattccaac
cgcgccactttcattgcggccgacgatagccaggcccttgctggattccgtgccctcgcc
caacacgagggtatcatccccgctctggagtcctcgcacgccgtctggggcgttatgcaa
attgctaagaccatggagaagggccagaatattgtcctcaacttgagtggtcgcggcgac
aaggatgtccagcaggttgccgacgagctgccccgtctggggcccaagatcgactgggat
ctgcgcttctaa

DBGET integrated database retrieval system