KEGG   Penicillium rubens: Pc22g13580Help
Entry
Pc22g13580        CDS       T01091                                 

Definition
(RefSeq) Pc22g13580
  KO
K22276  
glucan endo-1,6-beta-glucosidase [EC:3.2.1.75]
Organism
pcs  Penicillium rubens
Brite
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.75  glucan endo-1,6-beta-glucosidase
     Pc22g13580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
AA seq 488 aa AA seqDB search
MLPSILPLLLLSVLAEAAPGKRATAASAYCSNSDGNYKLSSIAPPVQGSGSPGSGSTWKL
SIDDTSSGHKQTIVGFGAAVTDATVTSFNTLSSSTLQQLLNELMTGAGAGFALMRHTIGA
SDLSGDPSYTYDDNGNSAGPSLSSFNLGDRGNAMATMLAKMKSLQSSLKILGSPWSAPGW
MKLNGVIDRTTKDNNLNDGYLTRGGTGSTGYASAFAQYFVKYIQAYEDLGAHIDAITIQN
EPLHSQAGYPTMYMFDYESAQLIQNYVGPALAQAGMNTDIWAYDHNTDMPSYPQNVINVA
GQYVDSVAWHCYAANVDWTVLTQFHETNPNIKQYMTECWTPASASWNQAADFTMGPLQNW
ASGVMAWTLGTNDQDGPHLSSGGCANCRGLVTIANGGYTFNPAYYMMAQFSKFMPPGAIV
LSGTGSYTYSNGGGVQSVASLNPDGTRTVVVENTFSNDIYITLSTNSGQEWSGNIPSQSV
TTWVLPAA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgcttccatctattcttcctctgctcttgctttcggtgctagcagaggcagcaccagga
aagcgagcaactgctgcatcagcctactgctcaaactcagatggcaactataagctctca
tcaattgcaccaccagtccagggcagtggcagtcctggttctggatcgacctggaagctg
agcattgatgatacatccagcgggcacaaacaaaccattgtgggcttcggagccgctgtc
accgatgccacagtcacctctttcaacacgctgtccagctcaacgctgcaacaactgctc
aacgagctgatgaccggtgctggtgctggtttcgctttgatgcgccatacgattggcgct
tccgacctctctggggatccatcgtatacttatgatgataacgggaatagtgcgggtcca
tctctgtctagttttaacctgggcgaccgtggaaatgccatggctacgatgctggctaag
atgaagtcccttcagtcaagtttgaagattctgggttctccttggagtgcccccgggtgg
atgaagctaaacggtgtgattgatcgcactactaaagataataacctgaacgatggctac
ttgactaggggaggcactgggagtactgggtatgccagtgcctttgcacagtatttcgtc
aagtacatccaggcttacgaagatctcggcgcccacatcgatgcaattaccatccaaaat
gagcctttgcacagccaagctggatatcctacgatgtatatgtttgactacgagtctgca
cagttgatccagaattatgttggtccagctctcgctcaagccggcatgaacaccgatatc
tgggcatatgatcacaacaccgacatgccatcctaccctcagaacgtcatcaacgtggct
ggccagtatgtcgactcggtagcatggcactgttatgccgccaatgtagattggacagtt
ctcacccaattccacgagacaaaccccaacatcaaacaatacatgacagaatgctggacc
cccgcatccgcatcgtggaaccaagcagccgatttcaccatggggcctttgcaaaattgg
gcatcgggcgttatggcctggacactaggtacaaatgatcaagacggtccgcatttgtca
agtggcggctgtgcaaactgtcgaggtctggtgactatcgccaacggtggatataccttc
aacccagcatactatatgatggctcaattcagcaagtttatgccgccgggtgccattgtg
ctgagtggcaccgggagctacacgtattccaatggtggaggagtgcagtctgttgcttcg
ctgaatccagatgggactcgcacagttgttgttgagaacacgttcagtaatgatatttac
attactttatcgactaatagtggtcaggaatggagtggcaatattccgagtcagtctgtg
acaacctgggtacttcctgcagcatga

DBGET integrated database retrieval system