KEGG   Penicillium chrysogenum: Pc22g13580Help
Entry
Pc22g13580        CDS       T01091                                 

Definition
Pc22g13580
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
pcs  Penicillium chrysogenum
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Pc22g13580
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Pc22g13580
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Pc22g13580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 488 aa AA seqDB search
MLPSILPLLLLSVLAEAAPGKRATAASAYCSNSDGNYKLSSIAPPVQGSGSPGSGSTWKL
SIDDTSSGHKQTIVGFGAAVTDATVTSFNTLSSSTLQQLLNELMTGAGAGFALMRHTIGA
SDLSGDPSYTYDDNGNSAGPSLSSFNLGDRGNAMATMLAKMKSLQSSLKILGSPWSAPGW
MKLNGVIDRTTKDNNLNDGYLTRGGTGSTGYASAFAQYFVKYIQAYEDLGAHIDAITIQN
EPLHSQAGYPTMYMFDYESAQLIQNYVGPALAQAGMNTDIWAYDHNTDMPSYPQNVINVA
GQYVDSVAWHCYAANVDWTVLTQFHETNPNIKQYMTECWTPASASWNQAADFTMGPLQNW
ASGVMAWTLGTNDQDGPHLSSGGCANCRGLVTIANGGYTFNPAYYMMAQFSKFMPPGAIV
LSGTGSYTYSNGGGVQSVASLNPDGTRTVVVENTFSNDIYITLSTNSGQEWSGNIPSQSV
TTWVLPAA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgcttccatctattcttcctctgctcttgctttcggtgctagcagaggcagcaccagga
aagcgagcaactgctgcatcagcctactgctcaaactcagatggcaactataagctctca
tcaattgcaccaccagtccagggcagtggcagtcctggttctggatcgacctggaagctg
agcattgatgatacatccagcgggcacaaacaaaccattgtgggcttcggagccgctgtc
accgatgccacagtcacctctttcaacacgctgtccagctcaacgctgcaacaactgctc
aacgagctgatgaccggtgctggtgctggtttcgctttgatgcgccatacgattggcgct
tccgacctctctggggatccatcgtatacttatgatgataacgggaatagtgcgggtcca
tctctgtctagttttaacctgggcgaccgtggaaatgccatggctacgatgctggctaag
atgaagtcccttcagtcaagtttgaagattctgggttctccttggagtgcccccgggtgg
atgaagctaaacggtgtgattgatcgcactactaaagataataacctgaacgatggctac
ttgactaggggaggcactgggagtactgggtatgccagtgcctttgcacagtatttcgtc
aagtacatccaggcttacgaagatctcggcgcccacatcgatgcaattaccatccaaaat
gagcctttgcacagccaagctggatatcctacgatgtatatgtttgactacgagtctgca
cagttgatccagaattatgttggtccagctctcgctcaagccggcatgaacaccgatatc
tgggcatatgatcacaacaccgacatgccatcctaccctcagaacgtcatcaacgtggct
ggccagtatgtcgactcggtagcatggcactgttatgccgccaatgtagattggacagtt
ctcacccaattccacgagacaaaccccaacatcaaacaatacatgacagaatgctggacc
cccgcatccgcatcgtggaaccaagcagccgatttcaccatggggcctttgcaaaattgg
gcatcgggcgttatggcctggacactaggtacaaatgatcaagacggtccgcatttgtca
agtggcggctgtgcaaactgtcgaggtctggtgactatcgccaacggtggatataccttc
aacccagcatactatatgatggctcaattcagcaagtttatgccgccgggtgccattgtg
ctgagtggcaccgggagctacacgtattccaatggtggaggagtgcagtctgttgcttcg
ctgaatccagatgggactcgcacagttgttgttgagaacacgttcagtaatgatatttac
attactttatcgactaatagtggtcaggaatggagtggcaatattccgagtcagtctgtg
acaacctgggtacttcctgcagcatga

DBGET integrated database retrieval system