KEGG   Penicillium chrysogenum: Pc22g14540Help
Entry
Pc22g14540        CDS       T01091                                 

Definition
Pc22g14540
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
pcs  Penicillium chrysogenum
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Pc22g14540
  Lipid metabolism
   00600 Sphingolipid metabolism
    Pc22g14540
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Pc22g14540
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Pc22g14540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1053 aa AA seqDB search
MGSPQTEELAMQADPKCPDFMNPAVFRRNTLPARSYHIPSTSLLLNGVWEFNMSQSPPEA
PEPNEKASDGDWSSINVPGHWQLQGWGKPNYTNTQFPIPVCPPFVPTENPTGTYRRKFQV
PAEWQANKPEVRLRFDGVDSAYHVWVNKSLVGYAQGSRNPSEFDVTPFLQEGDNEVFVRV
YQWSDATYIEDQDQWWLSGIFRDITLIALPTNDRLNDWFIRTDLDAEYENATLLATIDYQ
VSEKSTITLNLIETVESNSHVIASTECTVEPTKSAVELSLPVANPKKWTAEQPYLYEVEM
LLKTPRSDETFKTTQRTGFRKVERKGGLITVNGKAIQLRGVNRHDHHPLLGRAVPVEFMR
KDLLLMKAHNVNALRCSHYPPDPRLLDMADELGFWVIDEADLECHGFYDAVSRPMDMDET
LGYEERKAMTFPKCGTHTSDNPTWRAAYVDRVHSLIQRDKNHASIIIWSMGNEAFFGTCQ
RSMVEYARAFDSTRLVHYEGDIHAETTDMFSYMYPEISRLRSLAATEGVSNNGKFDKPII
LCEYAHAMGNGPGLLTEYEKCFDEIPRLQGGFIWEWANHGLYVEGNNQKDGFYAYGGDFD
DYPNDGTFVMDGLLNSAHQPLPGLLELKRAFEPVKLEVSGQALALKNRYNFSDLSHLQAS
YKLESFDKEAKTLETGPLELPILHAGQTAEIPLPTDLFQHKVHPAYLTITVEQRGKVEWD
QGAFVVAWTQQLVSKPTEKIPVSLSSAQDAISTNSTKTTVAVSGANWSFEFDRIRGHLRK
WTYNSTSILEPHPDTGLAMVPGFWRPPTDNDVPSAAPYSKRFGVNNLTNQFRSFNMFSME
NEGVCIETETFLSPPVLSWGWKCLARYTITPNGSLSITISLQPTGAAPATVPRVGMNLRA
NSNLQSARWLGLGPGESYPDKKAAQKFGLWNVDDIASLQTVYDIPQENGNRTDTAWVELL
TKNGIGFRASPQQSTVVNGGTASLNWTASQYSDKTIEAAQHPCDLVKDDAVFLRLDDQVA
GVGTAACGPGPMDEHLVKVQDITFGMLLEPVSL
NT seq 3162 nt NT seq  +upstreamnt  +downstreamnt
atgggctctccgcagaccgaagagctggccatgcaggccgatcccaaatgccctgacttc
atgaaccccgcggtttttcgcagaaataccctccccgcgcgttcttatcatattccctct
acatctctacttctcaatggagtctgggaattcaatatgtcccagtcaccaccggaggct
cccgagcctaacgagaaggcttctgatggggactggtctagcatcaacgtcccaggtcac
tggcagttgcagggttggggaaagccaaattataccaacacacaattccccatcccagtg
tgtcctcctttcgtacccaccgagaaccccacgggcacataccgtcggaagttccaagtg
ccggccgagtggcaggccaacaaaccagaggtccgtttgcgattcgacggcgtcgatagc
gcgtaccacgtttgggtgaataagtccctggtcgggtacgcgcagggtagcagaaacccc
tctgaatttgacgtcacaccatttttgcaggaaggtgacaatgaagtctttgtgcgggtg
taccagtggtcagacgctacgtatatcgaagatcaggatcagtggtggctatctgggatt
ttccgggacatcactttgattgcgctcccaaccaacgatcgtttgaatgactggttcatt
cgcacagatctcgatgcagaatacgaaaatgcgacgcttctcgcaacaattgactatcaa
gtctcggagaaaagcactattacactcaatttaattgagacggtagagagcaacagccat
gtcattgcttctacagagtgcaccgtggagccaacaaaatccgcagttgaactcagcttg
cctgttgccaaccccaagaaatggactgccgagcagccgtatctgtacgaagtggagatg
ctcctgaaaactcctagatccgacgagacgttcaaaactactcagcgcactggtttccgc
aaagttgagcggaagggtggtctcattaccgtcaacggaaaggctattcagcttcgtgga
gtcaaccgacacgatcaccacccccttttgggtcgtgccgtgccggtggaatttatgagg
aaagatctgcttctcatgaaagctcacaacgtcaatgcccttcgctgcagccactatccc
cctgaccctcggcttcttgatatggctgatgagctgggcttctgggttatcgatgaagcc
gatcttgaatgccatggcttctatgacgccgtctcacgcccaatggacatggacgaaact
cttggatacgaggagcgcaaggcaatgactttccccaagtgtggtacacatacgtcagac
aatcctacctggcgggcagcctacgttgatcgagttcattctctgatacagcgagacaag
aaccatgctagtattatcatctggtctatggggaatgaggcttttttcggtacatgtcaa
cgctctatggtagagtatgcccgggccttcgacagtacacgcttggtccactacgagggc
gacattcatgcggaaactacagacatgttcagctacatgtacccggagatcagccggctg
cggtctttggcagccactgagggtgtctcgaacaatggcaagttcgacaaacctatcatt
ctatgtgagtacgctcatgccatgggtaacggacccggcctgcttacggagtacgagaaa
tgcttcgatgagatcccgcgtttgcagggtggtttcatctgggaatgggccaaccacggg
ttgtacgttgaaggaaacaaccagaaagacggcttttatgcctatggtggtgacttcgac
gactatccgaatgatggaacgtttgtgatggatggtctcttgaacagcgcccaccagcct
ctgccaggtctgttggagctgaagagagcctttgaaccagtcaagttggaagtcagtgga
caggctttggctctaaagaaccggtacaacttctcggatctaagccatcttcaagcttca
tacaagcttgagtcgtttgacaaagaagcaaaaaccttggaaaccggaccgctggagctg
cccattctacacgccggccaaactgctgagattcctctcccgacagatctcttccaacac
aaagtccacccggcctatctgactattacagttgagcaacgaggaaaggttgaatgggat
cagggggcctttgtcgttgcttggacccaacagctggtatcaaagccaaccgagaaaatc
ccagtcagcttgagctctgctcaggatgctatctcgaccaactccaccaagacaactgtg
gctgtcagcggagccaactggtcctttgagtttgaccgcattcggggacatctcaggaag
tggacatacaactcgacgtctattcttgagccgcatcccgacacagggcttgccatggta
cctggtttctggcgtcctccgacagacaacgacgtaccttctgcggcgccctattcgaag
cgattcggagtgaacaatctcacaaaccagttccgttcattcaacatgttttcgatggag
aatgaaggtgtttgtatcgaaaccgagacgttcctctcgcctccagttctttcctgggga
tggaaatgtctcgcgcgttacaccatcactcccaacgggtcgttgtcaattaccataagc
ttgcaaccgactggagctgcaccggcaactgttcctcgtgtcggtatgaatcttcgcgca
aactctaatttgcagtcagcacgctggctcggacttggtcctggagaatcctatccggac
aagaaggctgcccagaagtttggtttgtggaatgttgatgacatcgcgtcactacagacg
gtttatgacattccacaggagaatggaaaccgcactgacactgcttgggtggagcttctc
actaagaacggcataggcttccgcgcaagcccgcaacaaagtacagtggtcaacggagga
acggcaagcttgaactggacagctagtcaatactccgataagactattgaggcggcacaa
cacccttgtgatctggtcaaagatgacgcggtgtttttgagattggatgaccaagttgca
ggcgtgggaactgcagcctgtggcccagggcctatggatgagcatctggttaaggtgcag
gatatcacctttggtatgctgttagagcctgtttctttgtga

DBGET integrated database retrieval system