KEGG   Penicillium chrysogenum: Pc22g14760Help
Entry
Pc22g14760        CDS       T01091                                 

Definition
Pc22g14760
Orthology
K06634  
cyclin H
Organism
pcs  Penicillium chrysogenum
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    Pc22g14760
  Replication and repair
   03420 Nucleotide excision repair
    Pc22g14760
Transcription machinery [BR:pcs03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     Pc22g14760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 419 aa AA seqDB search
MIEDDIYRASSQYRLWSYTEPSLQSLRATTNAVASERVRAALRRSCEAHQSTATSAAGTP
LPESNMEVKNKDEKDVECLTPEEELVLVRYYCEKTLELGETYKPPIPTMVRATAIQYLRR
FYLTNSPMTYHPKSIMACALFVATKTDNYYISLRQFADGIPGDTTTEDVIAPEFLLMQGL
RFTFDVRHPFRGLEGGVLELQAIAQGQGQPAPHLPYETAEDLQQGLLSIAPPPVPSSSMS
DRIARAHGTTRELLKSAAQMTDAYFLYTPSQIWFSAFLLADRPLAEFLLDVKLAPETDEN
GLVNPLYEIRSKLHHVLTECSALLQSYTPLSSDPAQMKSLKRIAKKLYHCQNPEKVNLAA
AQKRESTQPSTAVQSDAGIVTSESETERLAKKRKLEQEQKVRQEDDVFGPELVTQRTKQ
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgattgaagacgacatttaccgtgcctcatcccagtaccggctgtggtcatacaccgag
ccctctctgcaatctctcagagccacgacaaatgccgttgccagcgagcgcgtgcgcgcc
gctttgcgcagatcgtgcgaagctcatcagtcgactgcaacctccgcggcgggaacacca
ctaccggaaagcaatatggaagtcaagaataaagatgagaaggacgttgaatgcttgacg
ccagaggaggagctcgttctcgtgcgctattactgcgagaagacgctagagctgggagag
acatacaagccaccaattccgacaatggtccgggccaccgcgatccaatacctccgccgc
ttctacctaaccaattcgcccatgacataccatccaaagtcgatcatggcgtgtgcgctc
ttcgtcgccactaaaaccgataactactatatttcccttcggcaatttgcagatgggatc
cccggcgacacaacgacagaggacgtcatcgcaccagaattcctgctcatgcagggactc
cgtttcacttttgatgtacggcatccattccggggacttgaaggcggcgtcctggaacta
caagccatcgcacaaggccaaggccagccagccccccatctaccatacgagaccgcagaa
gatctccaacaaggattgctgtccatcgcacctcctcccgtcccatcgtcctcaatgtca
gatcgaatcgctcgtgcccacggcacgactcgtgagctgctgaaatccgctgcgcagatg
acggacgcctacttcttgtacacaccatcccaaatctggttttccgccttcttactggcg
gatcgtcccctagccgagtttttgctggatgtgaaacttgcccccgaaacagacgaaaat
ggcctggtgaaccctctatacgaaatccgctccaagctgcatcacgtcttgactgaatgc
tctgcgcttctccaatcctacacacccctctcctccgacccggcgcaaatgaagagcctc
aaacgcatcgcaaagaaactgtatcattgtcagaaccccgagaaggtgaatctggctgct
gctcagaaacgggaatcaacccaaccatccacagctgttcaaagtgacgctgggattgtc
acttcggagagcgaaacagaacgcctagcgaagaagcggaaattggaacaagaacagaaa
gtccgccaagaagacgacgtttttggtccggagttggtcactcagcggaccaagcagtaa

DBGET integrated database retrieval system