KEGG   Penicillium chrysogenum: Pc22g16500Help
Entry
Pc22g16500        CDS       T01091                                 

Definition
Pc22g16500
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
pcs  Penicillium chrysogenum
Pathway
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:pcs04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 374 aa AA seqDB search
MVFSKINGNLHHREKQLVESLRHSPRSSNPFLITERQDEKQLCISSRSLHVNDFALVKTL
GTGTFARVWLARLKDQKDKDKVYALKILRKADVIKLKQVEHVRNERKALAAVVDHPFITT
LIASFSDEKCLYMLLDYCPGGEIFTYLRRQRRFSEEVSTFYAAEITMTIEFLHDVHGVAY
RDLKPENILLDADGHLKLVDFGFAKQVDNRETYTLCGTPEYLAPEVIQNSGHGLAVDWWA
LGILIYEFLIGQPPFWDQNPMRIYEQIIEGRLRFPPNMPAAAQNIVSLLCKTNPTERLGH
ISGGSTRVKSHPFFQDVIWDDLFYRRVKGPIIPRLSHPADTGNFEEYPDPPDLRNTNIYT
EDLKKKYEPLFSDF
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggtcttctccaagataaatggcaacctgcaccacagggaaaagcaactcgtcgagtcc
ctccgccattctccgcgatcctcgaaccctttcctcatcaccgagcgccaggacgagaag
caactgtgcatttcctcgaggagtctgcatgtgaacgattttgcgctcgtcaagactctt
ggaaccggcactttcgctcgggtgtggctcgcaaggttaaaagaccaaaaggacaaggac
aaagtctatgcgttgaaaattcttcgaaaggcggacgtgatcaaactcaagcaagtggaa
catgtgcgcaacgagcgaaaggccctcgcagcggtggttgaccaccctttcatcaccaca
ttgatcgcatcattctcggatgagaagtgcctctacatgctgctggactattgtcctgga
ggtgaaatattcacgtatctacgacgccaacgacgctttagcgaagaagtctcgacattc
tatgcggccgaaataacaatgacaatcgagttcctacacgacgtccacggagtcgcctac
cgagatctcaaaccggagaatatcctgttggacgccgacggtcaccttaagcttgttgac
ttcggctttgcgaagcaagtcgataaccgcgagacgtacacattatgcggcacgccggaa
tacctagctccagaggtcattcaaaacagcggacatggacttgcagtggactggtgggct
cttggaatcttgatttacgaattcttgatcggacagcctcctttctgggatcagaaccct
atgcgcatctacgagcagatcatcgaaggccgtctacgcttcccgcccaatatgccggct
gcagcacagaacattgtctccttactctgcaaaacaaatccgacggagcgactgggccac
atctctggtggctcgactcgagtcaagtcccatcctttctttcaagatgtcatttgggac
gatttgttttatcgccgggtgaaagggcctataattccccgcctatcacaccccgcggac
acgggtaattttgaagaatacccggatccccccgacctcagaaacacgaacatctacacg
gaggatctgaagaagaagtacgagccgttattcagtgacttctga

DBGET integrated database retrieval system