KEGG   Penicillium chrysogenum: Pc22g16500Help
Entry
Pc22g16500        CDS       T01091                                 

Definition
Pc22g16500
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
pcs  Penicillium chrysogenum
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    Pc22g16500
Enzymes [BR:pcs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Pc22g16500
Protein kinases [BR:pcs01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   Pc22g16500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 374 aa AA seqDB search
MVFSKINGNLHHREKQLVESLRHSPRSSNPFLITERQDEKQLCISSRSLHVNDFALVKTL
GTGTFARVWLARLKDQKDKDKVYALKILRKADVIKLKQVEHVRNERKALAAVVDHPFITT
LIASFSDEKCLYMLLDYCPGGEIFTYLRRQRRFSEEVSTFYAAEITMTIEFLHDVHGVAY
RDLKPENILLDADGHLKLVDFGFAKQVDNRETYTLCGTPEYLAPEVIQNSGHGLAVDWWA
LGILIYEFLIGQPPFWDQNPMRIYEQIIEGRLRFPPNMPAAAQNIVSLLCKTNPTERLGH
ISGGSTRVKSHPFFQDVIWDDLFYRRVKGPIIPRLSHPADTGNFEEYPDPPDLRNTNIYT
EDLKKKYEPLFSDF
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggtcttctccaagataaatggcaacctgcaccacagggaaaagcaactcgtcgagtcc
ctccgccattctccgcgatcctcgaaccctttcctcatcaccgagcgccaggacgagaag
caactgtgcatttcctcgaggagtctgcatgtgaacgattttgcgctcgtcaagactctt
ggaaccggcactttcgctcgggtgtggctcgcaaggttaaaagaccaaaaggacaaggac
aaagtctatgcgttgaaaattcttcgaaaggcggacgtgatcaaactcaagcaagtggaa
catgtgcgcaacgagcgaaaggccctcgcagcggtggttgaccaccctttcatcaccaca
ttgatcgcatcattctcggatgagaagtgcctctacatgctgctggactattgtcctgga
ggtgaaatattcacgtatctacgacgccaacgacgctttagcgaagaagtctcgacattc
tatgcggccgaaataacaatgacaatcgagttcctacacgacgtccacggagtcgcctac
cgagatctcaaaccggagaatatcctgttggacgccgacggtcaccttaagcttgttgac
ttcggctttgcgaagcaagtcgataaccgcgagacgtacacattatgcggcacgccggaa
tacctagctccagaggtcattcaaaacagcggacatggacttgcagtggactggtgggct
cttggaatcttgatttacgaattcttgatcggacagcctcctttctgggatcagaaccct
atgcgcatctacgagcagatcatcgaaggccgtctacgcttcccgcccaatatgccggct
gcagcacagaacattgtctccttactctgcaaaacaaatccgacggagcgactgggccac
atctctggtggctcgactcgagtcaagtcccatcctttctttcaagatgtcatttgggac
gatttgttttatcgccgggtgaaagggcctataattccccgcctatcacaccccgcggac
acgggtaattttgaagaatacccggatccccccgacctcagaaacacgaacatctacacg
gaggatctgaagaagaagtacgagccgttattcagtgacttctga

DBGET integrated database retrieval system