KEGG   Penicillium rubens: Pc22g16960Help
Entry
Pc22g16960        CDS       T01091                                 

Definition
(RefSeq) Pc22g16960
  KO
K04709  Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
pcs  Penicillium rubens
Pathway
pcs00600  Sphingolipid metabolism
pcs01100  Metabolic pathways
Module
pcs_M00094  Ceramide biosynthesis
pcs_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Pc22g16960
Enzymes [BR:pcs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     Pc22g16960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAM_LAG1_CLN8 TRAM1
Motif
Other DBs
NCBI-GeneID: 8312181
NCBI-ProteinID: XP_002565609
UniProt: B6HS06
AA seq 450 aa AA seqDB search
MADTVVPSQPVELKGRNVYVSSPSGIRPAKETTFREWVVANQIGISMTTLAMLLALHNLY
PSLRPYTQPFFQLSYYNESSNSYVQGWNDVYFVISAAIALTGIRAIAIEWFLQPLARACG
LKRKQSLRLAEQGWQAMYYSFIWGVGLYLWKTSYYWGDFAAMWSQWPARPLSGLMKWYLL
VELAFLVQQIFVIHVEERRKDHVQMLSHHIITSALLSSAYIYAMYNVSNVVLCLMDVVDF
LLPSAKILKYSKFETACNVGFGLFMGTWFITRHIIYPMVCWSVYYDLPRELTYGCYTGST
SEFISAEAPNAFAYMLGPYFSLDNPICFNPTLKWMFLSLLLILEVLSIVWFSMIVRVAYG
VVCGGNAEDTRSDEEDEAEVEGQTPSRVPAHLAAKDGAPADPLETGNAPGLGRRRSNGTA
SVRARGRGRVPFDPSDRKALLGRIGCEKPT
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggcagacacagttgtgccatcgcagccagtagagctgaaggggcgcaatgtctacgtt
tcctctcccagtggaatacggccggccaaggagaccacgttccgcgaatgggtggttgcc
aaccagatcggaatctccatgaccacgctggctatgctgctggctcttcataacctctac
ccatcgctccgtccatatacccagccattcttccaattgtcctattataatgaatcctcg
aactcctacgtgcagggctggaacgatgtctacttcgtaatcagtgctgccattgcactc
accggtatccgcgctatcgccatcgaatggttcctgcaaccattggcccgcgcatgcggg
ttaaagcgcaaacagtcgctccgcctcgctgagcagggttggcaagctatgtactattcg
ttcatttggggagtcggattgtacctctggaagacgtcatactactggggagattttgcc
gctatgtggtcacagtggcccgcccgtcctttgtcgggcttgatgaagtggtatcttctc
gttgagctggcattccttgtgcagcagatcttcgtgattcacgtggaagagagacggaag
gaccatgttcagatgctttcccaccacattattaccagtgctctcctcagctctgcctac
atctacgccatgtataatgtgtccaatgtagtgctatgtctcatggatgtcgtggacttc
ttgttaccgtctgcgaagatcctcaagtactccaagttcgaaacagcctgcaacgttggc
ttcggcctcttcatgggcacatggttcattacccgacacatcatctaccccatggtgtgc
tggtccgtttattatgatctcccccgtgaactcacctatggctgctacaccggctcgaca
agcgagttcatctcagcggaggccccaaatgccttcgcatacatgctcggtccatacttc
agtttggacaaccccatctgcttcaaccccactctcaaatggatgttcttatccctcctg
ttgatcctcgaggtactgtccattgtatggttcagcatgattgtccgtgtcgcttacggt
gtggtttgtggcggtaatgccgaagatacccgcagtgacgaggaagacgaagcggaagtg
gaaggtcagaccccatctcgcgtcccagcgcacttggctgccaaggacggtgcccctgcc
gacccactggaaactggaaacgctccaggcttgggtcgtcggcggtccaacggcactgcc
tcggtgcgcgcgcgtgggcgtggtcgtgttcctttcgatccgagtgatcggaaagctctc
ttgggtcgcattggatgtgaaaagcctacataa

DBGET integrated database retrieval system