KEGG   Penicillium chrysogenum: Pc22g16960Help
Entry
Pc22g16960        CDS       T01091                                 

Definition
Pc22g16960
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
pcs  Penicillium chrysogenum
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Pc22g16960
Enzymes [BR:pcs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     Pc22g16960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 450 aa AA seqDB search
MADTVVPSQPVELKGRNVYVSSPSGIRPAKETTFREWVVANQIGISMTTLAMLLALHNLY
PSLRPYTQPFFQLSYYNESSNSYVQGWNDVYFVISAAIALTGIRAIAIEWFLQPLARACG
LKRKQSLRLAEQGWQAMYYSFIWGVGLYLWKTSYYWGDFAAMWSQWPARPLSGLMKWYLL
VELAFLVQQIFVIHVEERRKDHVQMLSHHIITSALLSSAYIYAMYNVSNVVLCLMDVVDF
LLPSAKILKYSKFETACNVGFGLFMGTWFITRHIIYPMVCWSVYYDLPRELTYGCYTGST
SEFISAEAPNAFAYMLGPYFSLDNPICFNPTLKWMFLSLLLILEVLSIVWFSMIVRVAYG
VVCGGNAEDTRSDEEDEAEVEGQTPSRVPAHLAAKDGAPADPLETGNAPGLGRRRSNGTA
SVRARGRGRVPFDPSDRKALLGRIGCEKPT
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggcagacacagttgtgccatcgcagccagtagagctgaaggggcgcaatgtctacgtt
tcctctcccagtggaatacggccggccaaggagaccacgttccgcgaatgggtggttgcc
aaccagatcggaatctccatgaccacgctggctatgctgctggctcttcataacctctac
ccatcgctccgtccatatacccagccattcttccaattgtcctattataatgaatcctcg
aactcctacgtgcagggctggaacgatgtctacttcgtaatcagtgctgccattgcactc
accggtatccgcgctatcgccatcgaatggttcctgcaaccattggcccgcgcatgcggg
ttaaagcgcaaacagtcgctccgcctcgctgagcagggttggcaagctatgtactattcg
ttcatttggggagtcggattgtacctctggaagacgtcatactactggggagattttgcc
gctatgtggtcacagtggcccgcccgtcctttgtcgggcttgatgaagtggtatcttctc
gttgagctggcattccttgtgcagcagatcttcgtgattcacgtggaagagagacggaag
gaccatgttcagatgctttcccaccacattattaccagtgctctcctcagctctgcctac
atctacgccatgtataatgtgtccaatgtagtgctatgtctcatggatgtcgtggacttc
ttgttaccgtctgcgaagatcctcaagtactccaagttcgaaacagcctgcaacgttggc
ttcggcctcttcatgggcacatggttcattacccgacacatcatctaccccatggtgtgc
tggtccgtttattatgatctcccccgtgaactcacctatggctgctacaccggctcgaca
agcgagttcatctcagcggaggccccaaatgccttcgcatacatgctcggtccatacttc
agtttggacaaccccatctgcttcaaccccactctcaaatggatgttcttatccctcctg
ttgatcctcgaggtactgtccattgtatggttcagcatgattgtccgtgtcgcttacggt
gtggtttgtggcggtaatgccgaagatacccgcagtgacgaggaagacgaagcggaagtg
gaaggtcagaccccatctcgcgtcccagcgcacttggctgccaaggacggtgcccctgcc
gacccactggaaactggaaacgctccaggcttgggtcgtcggcggtccaacggcactgcc
tcggtgcgcgcgcgtgggcgtggtcgtgttcctttcgatccgagtgatcggaaagctctc
ttgggtcgcattggatgtgaaaagcctacataa

DBGET integrated database retrieval system