KEGG   Penicillium chrysogenum: Pc22g17940Help
Entry
Pc22g17940        CDS       T01091                                 

Definition
Pc22g17940
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pcs  Penicillium chrysogenum
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pcs00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 567 aa AA seqDB search
MCGIFACHQFSYSHPDVQKFKPTALRMAKAVRHRGPDWILAHERLSIVGVDSGAQPLVND
DSSLALAVNGEIYNHRLIRKNLHHKYNFKTHSDCEVIIPLYEEYGLDAPKHLDGMFSWVL
WDKKQDRVVAARDPIGITSFYLGRSSSTPGAVFFASELKCLHPVCDNIIAFPPGHVYDSK
TDSLTRYFEPKWWDPTNVPTTPVDYKVVRQSLEKAVRKRLMAEVPYGVLLSGGLDSSLVA
SIAQRETLRMAEAARKAPQNLNADGELVGIDDENDLSTVTTFQQLHSFSIGLPGAPDTEA
ALEVAKFLGTKHHPFTFTVEDGLDALSDVIYHLETYDVTTIRASTPMYLLSRKIKAMGVK
MVLSGEGSDEIFGGYLYFHAAPNKEELHKETVRRVKNLHLADCLRANKSTSAWGLEARVP
FLDKEFLETCMGVDPQDKMITPERIEKHMLRKAFDTSDEPETAAYLPDKILWRQKEQFSD
GVGYSWIDGLKDEAERQVTDEMMKNPKPEWGTDVPDTKEAYWYRTMFDEHFPPYCAGTVE
RWTPTWSKQTDPSGRAIAIHNQKYDKE
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattttcgcgtgccaccagttctcctacagtcaccccgatgtgcaaaagttc
aagcctacggctttgcgcatggccaaggctgtgcgccaccgcggtcccgattggatcctg
gctcacgagcgtctgagcatcgtcggtgttgactccggtgcccagcccctcgtcaacgat
gacagcagcctcgccctcgccgtcaacggtgagatctacaaccaccgcctcattcgcaag
aacctccaccacaagtacaacttcaagacgcactctgattgcgaagttatcattcccttg
tatgaggagtatggccttgatgcccctaagcaccttgatggcatgttctcttgggttctt
tgggataagaagcaggaccgtgttgttgctgctcgtgaccccattggtatcaccagcttc
taccttggacgctcttcctccactcccggcgccgtcttctttgcctctgagctcaagtgc
ctgcaccccgtctgtgacaacatcattgccttccccccgggccacgtctatgattccaag
accgacagcttgacccgctacttcgagcccaagtggtgggaccccaccaacgtccccacg
acccccgttgactataaggtggtccgccagagtctcgagaaggccgtccgcaagcgtctg
atggctgaggttccctacggtgttttgctgtctggtggtctggactccagcttggtcgcg
tctatcgcccagcgtgagaccctccgcatggccgaagcagcccgcaaagctccccagaac
ctgaatgccgacggtgagttggttggcattgatgacgagaacgacctgtcgactgtcacc
accttccagcagctgcactcattctccatcggccttcctggtgcccccgataccgaggct
gcccttgaggttgccaagttccttggcaccaagcaccacccgttcaccttcactgttgag
gacggcctcgatgctctctctgacgttatctaccacctcgagacctacgatgtgaccacc
atccgtgcctctactcccatgtacctgctgtcccgtaagatcaaggccatgggtgtcaag
atggttttgagtggtgagggttccgacgagatcttcggtggctacctctacttccacgcc
gcccccaacaaggaggagctccacaaggagaccgtccgccgtgttaagaacttgcacttg
gctgactgccttcgtgccaacaagtccacctccgcatggggtcttgaggctcgtgttcct
ttcctcgacaaggagttcctcgagacctgcatgggtgttgacccccaggacaagatgatc
acccccgagcgtatcgagaagcacatgctgcgcaaggccttcgacacctccgatgagcct
gaaaccgctgcctacttgcccgataaaattctctggcgccagaaggagcagttcagcgat
ggcgttggctacagctggattgatggcctgaaggatgaggccgagcgccaggtcaccgat
gagatgatgaagaaccctaagcccgaatggggtactgacgttcccgacaccaaggaggca
tactggtaccgtaccatgttcgatgagcacttccctccttactgtgccggcactgtcgag
cgctggacccctacctggtccaagcagaccgaccccagtggaagagccatcgccatccac
aaccagaagtatgacaaggagtaa

DBGET integrated database retrieval system