KEGG   Penicillium chrysogenum: Pc22g18500Help
Entry
Pc22g18500        CDS       T01091                                 

Definition
Pc22g18500
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
pcs  Penicillium chrysogenum
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Pc22g18500
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Pc22g18500
Enzymes [BR:pcs01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     Pc22g18500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 410 aa AA seqDB search
MVAVSILTLGALFAQAWAMPTATESAVASAATSTAASTSLPVAESQLDDLAGLAYNSSMN
SVSSDSDIEKRGGCSLSKLRIRRDWRAFSTKQKKSYIKSILCLQELPSLTPSDKAPGARS
RYDDFVATHINQTTGIHYTGTFLAWHRYYIWNFEEAMRNECGYTGDFPYWNWGADAANLE
KSQVFDGSDTSMSGNGAYTESTGDIQLSLGNYPVIHLPTGTGGGCVTSGPFKDYSVNLGP
VALMLPGGETESTANPLAYNPRCLKRDLSSKIVHDYANFTAIVDLILRHDNIYDFQMNMQ
GVPGSGNIGVHGGGHYSMGGDPSRDVFVSPGDPAFWLHHGMIDRTWWIWQNLNPRKRMNA
ISGTGTFLNGPPSPNTTLDTLVDIGYAGGETVAMRDIMSTISGPFCYIYL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggttgctgtttccatcctcactctgggagctttgttcgcacaggcgtgggctatgccc
actgccactgagagtgccgttgcgagcgctgccacttccaccgctgcgtccacctccctg
ccggtcgctgagtcccagcttgacgacctggctgggctggcatacaacagcagcatgaat
agtgtctcgagcgactcagacattgagaagcgcggtggctgttcattgagcaagctgcgc
attcgtcgcgattggagggctttctctaccaagcagaagaagtcctacattaagtccatc
ctttgcctccaggagttgccctcgctcactccctccgataaggcccctggtgcgcggtcc
cgttacgacgacttcgtcgctactcacatcaatcagaccaccggcatccactacaccgga
accttcctggcatggcaccggtactacatctggaacttcgaggaagccatgcgcaacgag
tgtggctacactggcgacttcccttactggaactggggcgctgacgccgccaacctggaa
aaatcccaggtcttcgacggcagcgacacgtcaatgtccggcaacggtgcctacacagaa
tccaccggcgacatccagctaagcctgggtaactacccggtcatccacctgcccaccggc
acgggaggcggctgcgtcaccagcggcccgttcaaagactactctgtcaacctgggcccg
gtcgcgctgatgctgccaggaggtgaaacggaaagcacagccaacccgctcgcatacaac
ccccgctgtctgaagcgcgatctgagctccaagattgtccatgactacgctaatttcact
gcgatcgtggacctgatcctgcgccacgacaacatctacgacttccagatgaacatgcag
ggtgtccctggcagcggcaacatcggcgtccacggtggtggtcactactccatgggcggt
gatccttctcgtgatgtctttgttagccctggtgaccctgctttctggctccaccatggt
atgattgatcgcacttggtggatctggcagaacttgaaccccagaaagcgtatgaatgct
atttcgggcactgggactttcttgaacggccctccttcgcctaacactacccttgacacg
cttgttgatattggttatgctggtggcgagactgttgctatgcgagatatcatgagtacc
atctctggtcctttctgctacatctacctgtaa

DBGET integrated database retrieval system