KEGG   Penicillium chrysogenum: Pc22g18520Help
Entry
Pc22g18520        CDS       T01091                                 

Definition
Pc22g18520
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
pcs  Penicillium chrysogenum
Brite
Enzymes [BR:pcs01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     Pc22g18520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 363 aa AA seqDB search
MGATISTSWGALPSTAELFSPSPTVYTSVLCCFQYFPLMTVIQWILSWHPAGKTSSQSIF
NVPGRIAWSAMEIVGPINLIYSMVTPSPYAPSFTDLPKSNILIVALYCIHYFNRAIISPF
FSAPSMSPIHAVIMSFAMVFNWFNSACLAGWLRGYTVPTIPNFQTASSESPSPRSAVVNL
LPTVGVILFAIGMAGNIYSETALFRLRREEAEKRAAKKTDDGPPAGAEAQGSRNKFHKVY
VIPPSRGVFRYILYPHYVFEWLEWVGFALAGTAVAPFSALPASVSASSVGIAPPLRLAPW
LVPAAWAAGKLAVPLPLPAVVFVANAVTNMLPHARWGRKWYVEKFGEKAVAGRGAVVPGC
AWM
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcgactatttccacttcttggggagctctgccctccactgcagagctcttttcc
ccaagtccgactgtctacacatcagttctatgctgcttccaatacttccccctgatgaca
gtaattcaatggattttgtcctggcatccagcaggcaagacctcctcgcagtccatcttc
aacgtcccaggtcgtatcgcctggtctgccatggagattgtcggccctatcaacttgata
tatagcatggtcactccatcgccatatgcaccctcattcactgatctccctaagtccaac
atcctcattgtagctctgtactgcatccactatttcaaccgagccatcatctcccctttc
ttctccgcccccagcatgtccccaatccacgccgtcatcatgtccttcgccatggtcttc
aattggttcaattcagcctgtctggccggatggttgcgtggatataccgtcccgactatc
ccaaacttccaaacagccagcagcgaaagtccatctcctcgctctgcggtggtcaatctc
ctccccaccgtgggcgtaatcttgtttgccatcggaatggccggcaacatctactcagag
acagcattgttccgacttcggcgcgaagaagccgaaaaacgcgctgccaaaaagacagat
gatggacctccggcgggagctgaagcacaaggcagccgaaacaagttccacaaggtctac
gtcatcccgccttcccgtggtgtcttcagatacatcttgtatccgcactacgtcttcgaa
tggctggagtgggttggttttgctctcgctggtacggcggttgcgccattctctgctctc
cctgcatctgtctcggcgtcttctgtggggatcgctcctccgctgcgtcttgcgccttgg
ttggtgcctgctgcatgggcggctggtaagctcgctgtgccgctgcctttgcctgctgtg
gtgtttgttgccaatgctgtcacgaatatgttgccccatgcgcgctggggacggaagtgg
tatgttgagaagtttggggagaaggctgtcgctggcaggggggctgttgtccctggctgt
gcgtggatgtga

DBGET integrated database retrieval system