KEGG   Penicillium chrysogenum: Pc22g19230Help
Entry
Pc22g19230        CDS       T01091                                 

Definition
Pc22g19230
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pcs  Penicillium chrysogenum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pc22g19230
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Pc22g19230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 483 aa AA seqDB search
MKFTNIVLAASAATVACAYPRGRDAVPNKQSADIKKRANGFTWLGVSESGAEFGEGNIPG
TLEKDYTWPKTSQIQILRDAGMNIFRVPFLMERLVPTTMTGTPDATYMAALKSTVKFITD
SGAYAVLDPHNYGRYAGSIISSTSDFKAFWKTVATEFATNEKVIFDTNNEYHDLDQTLVL
DLNQAAIDAIRAAGATSQYIFVEGNAWSGAWSWTDNNDNLKALTDSEDKVVYEMHQYLDG
DSSGTSETCVSSTIGKERLQSATAWLQENNKKGFIGEFAGGVNSDCQAAVDGMLSYMTEN
SDVWMGAEWWAAGPWWGSYMYSLEPSDGPAYSTYLPILEKYFVDGTASAPASSSSSAPTS
TKSAAQTSTTTAAVDVTSTPSSNVQVPSSVVEPSSSASAPAETSAPVAPVVPTPTTVAPT
TLVSATSTSTAKPNAQVPTNSPSTGNVAKHYYQCGGINWTGPTVCETGTTCVKQNPYYYQ
CVA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcacaaacattgttctggctgctagcgccgccaccgtggcctgcgcatacccc
cgaggaagagacgctgtccctaacaagcagagcgctgatattaagaagcgtgcaaatgga
ttcacctggctcggtgtgagcgagtccggtgccgaattcggcgagggcaacattcccggt
accctggaaaaagactacacctggcccaagacttcccagattcagatcttgagagatgcc
ggtatgaacatcttccgtgtgcccttcttgatggagcgcctggtgccaaccaccatgacc
ggcaccccggatgccacttacatggccgcccttaagtctactgtcaagttcattaccgac
agtggtgcctatgccgtccttgatccccacaactacggaagatacgctggcagcatcatc
agctcgacctccgatttcaaggccttctggaagaccgttgctactgagttcgccaccaac
gagaaggtcatcttcgacaccaacaacgagtaccacgaccttgaccagaccctcgtcttg
gacctgaaccaggctgccattgacgctatccgtgccgctggcgccaccagccagtacatc
ttcgtcgaaggcaacgcctggagcggcgcctggtcctggaccgacaacaacgacaacctg
aaggccctcacggactccgaggacaaggttgtctacgagatgcaccagtacctggacggt
gacagctccggaacctccgagacctgcgtcagcagcaccatcggcaaggagcgtctccag
tccgccaccgcctggttgcaggaaaacaacaagaagggcttcatcggcgagttcgccggc
ggcgtcaacagcgactgccaggctgccgtcgacggcatgctctcctacatgaccgagaac
agcgacgtctggatgggcgccgagtggtgggccgccggtccctggtggggatcttacatg
tacagcttggagccaagtgacggccctgcttactcgacctacctccccatcctcgagaag
tacttcgttgacggcactgcctcggccccggcttcgtcttcttcctccgcccccacctct
accaagtctgctgcccagacatcgaccaccaccgccgctgtcgacgtcaccagcaccccc
agcagcaacgtccaggtccccagctccgtggttgagccgtccagctcggcctccgctccc
gctgagacttccgcccctgtcgcccctgttgtccctactcccaccactgtcgcccccact
accctcgtcagcgccacctccacctccactgccaagcccaatgctcaggtacctaccaac
agcccctctactggaaatgttgctaagcactactaccagtgcggtggtatcaactggact
ggccccactgtctgtgagactggcaccacctgcgtcaagcagaacccttactactaccag
tgcgttgcttaa

DBGET integrated database retrieval system