KEGG   Penicillium chrysogenum: Pc22g19630Help
Entry
Pc22g19630        CDS       T01091                                 

Definition
Pc22g19630
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
pcs  Penicillium chrysogenum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pcs00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 465 aa AA seqDB search
MNLKYPSPDIHRAFIALGSNVGDRVEMIEQACLEMDRVGIKVKRTSSLFETAPMYVLDQD
PFINGVCEVETTLAPLDLLDTLQSIEIAMGRKKLIDKGPRSIDLDILLYDREIVSHERLN
IPHNLMLERDFVLRPLSQLMPNECPPLPGKDKQTYSTHLKALPPPDPIPVSTTPISPLFP
SLRATDPKRSTHVMAILNLTPDSFSDGGKHSPTDLTYITETVRKFIASGATIIDIGGEST
RPGSTPVGAAEEIARVVPAIQHIRTSIPEAANIAISIDTYRASVAEAACAAGADIVNDIS
AGLLDPEMLPTVARIGKSVILMHMRGTPQTMTTLHEYPTGVIPEVAAELGARIAAAEDAG
IRRWRIILDPGLGFAKIQPLDLEILRELPRLRAMPGLEYFPWLMGPSRKRFIGHLTGVKT
PRERVWGTAATVSASVAGGADIVRVHDVHEMSQVTKVADAIYRVD
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgaaataccccagtccagacatccaccgggctttcattgccctgggaagtaat
gtcggggaccgagtagaaatgattgagcaggcttgtcttgaaatggaccgagttggtatc
aaagtgaaaaggacaagttcattgttcgagaccgcaccgatgtatgtgcttgatcaagat
ccattcatcaatggtgtatgcgaggtggaaacaactcttgcacctttggatcttttggac
actcttcaatccattgagattgcgatgggcagaaagaagctcatcgacaaaggtccacgc
tctattgacttggatatcctgctctatgatcgagagatcgtctctcacgaacgtctcaac
attccacacaacctgatgcttgaacgagactttgtattgcgacctctcagccagttaatg
ccaaatgaatgccctccactaccaggaaaggacaaacaaacatacagcacacatctgaag
gctctcccacctccagacccaatcccagtatcaacaaccccaatctcaccactattccca
tccctgcgcgcaacagatcccaagcgcagcacccacgtcatggcaattctcaatctaacg
ccagactccttctctgacggcggaaagcactccccaacagacctaacctatataacggag
acagtgcgcaaattcatcgcctccggcgcaacaatcatcgatattggcggcgagagcacc
cgcccaggctcaacaccagtcggtgccgccgaggagatcgcccgcgtagtaccagcaatc
cagcacatccgaacctcgatcccagaagccgccaacattgccatcagcatcgacacctac
cgcgccagcgtagcggaagccgcctgcgccgccggcgcagacatcgtcaacgacatctca
gccggcctcctcgacccagaaatgttaccgacagtagcgcggatcggcaagtccgtgatc
ctgatgcacatgcgcggcacgccgcagacaatgacgaccctgcacgagtaccctaccggc
gttatcccggaagtggctgctgagctgggcgcgcgcattgcggctgccgaagacgcgggg
atccggcgctggcgcatcatcctcgatccgggtcttggttttgcgaagatccagccgctt
gatctggagatcttgcgggagttgccgaggctgcgtgcgatgccgggacttgaatacttc
ccttggttgatggggcccagtcggaagaggttcattggtcatcttactggggtgaagacg
ccccgggagcgcgtttggggtacggctgctactgtctctgctagcgtggctggtggggcg
gatattgttcgtgttcatgatgtccatgagatgtcgcaggtgacgaaggttgcggatgcg
atttatcgcgttgattga

DBGET integrated database retrieval system