KEGG   Penicillium chrysogenum: Pc22g20500Help
Entry
Pc22g20500        CDS       T01091                                 

Definition
Pc22g20500
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
pcs  Penicillium chrysogenum
Brite
Protein kinases [BR:pcs01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   Pc22g20500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2384 aa AA seqDB search
MAQAGAITDVTQRLFVELKSKNEEARARAAYELYDNVLSVSRDWPSEKFVEFYNAVSQRI
AQLVVNGSDANERIGGLLALDRLIDFDGVDAAQKTTRFASYLRSALRSNDNVVLVYAARS
LGRLAKPGGALTAELVESEIQSALEWLQSERQESRRFAAVLVIRELAKGSPTLLYGFVPQ
VFELVWVALRDPKVLIRETAAEAVGECFEIIVARDSQVRQSWFARIHDEALLGLKSHNID
WIHGSILIIKELILKGTMFMKEHYRNACEIILRLKDHRDPKIRTEVVLTIPILASYAPTD
FTEIYLHKFMVYLQAQLKRDKERNSAFIAIGKIANAVGTAIGQYLDGIIIYIREGLAMKA
RNRSGVNEAPMFECISMLSLAVGQALSKYMEALLDPIFACGLSKSLTQALVDMAHYIPPI
KPMIQEKLLDMLSIILCGTPFRPLGCPENRLPPMPSFAKDFAPHELHSDSDIALALHTLG
SFDFSGHILNEFVRDVAINYVENDNPEIRKASALTCCQLFVHDPIINQTSGHSIQVVSEV
IDKLLTVGIGDPDPEIRRTVLWSLDRKFDRHLARPENIRCLFLAVNDEVFDVKEAAICII
GRLSSVNPAYVFPPLRKLLVNLLTGLGFANTARQKEETAQLISLFVSNATKLIRSYVDPM
VTALLPKSTDINPGVAATTLKAVGELASVGGHEMRQYLPQIMPIILDSLQDLSSHNKREA
ALRTLGQLASNSGYVIEPYMEYPHLLAVLINIIKTEQTGSLRKETIKLVGVLGALDPYKY
QQISEIEPDVHHINEIQNVSDVALIMQGLTPSNEEYYPTVVIHTLMQNILRENSLAQYHS
AVIDAIVTIFKTLGLKCVPFLGQIIPGFILVIRSAPASRLESYFNQMAILVNIVRQHIRT
FLPEIIEVIKDFWDASYQIQGTILSLVEAIARSLEGEFRKYLAGLIPLMLDTLDKDTSPR
RQPSEKILHALLIFGSSGEEYMHLIIPSIVRLFDRPQNPQSIRKSAIDSLTKLSRQVNVS
DFASLMVHSLSRVVAGGDRVLRQAAMDCICALIFQLGQDFTHYIHLLNKVLKTNQIAHTN
YQILVTKLQKGDPLPQDLNPEEVYSFPTDDTNFSEIGQKKIVVNQQHLKNAWDASQKSTR
DDWQEWIRRFSIELLKESPSPALRACASLAGIYQPLSRDLFNAAFVSCWTELYDQYQEEL
VRSIEKALTSPNISPEILQILLNLAEFMEHDDKALPIDIRTLGKYAAKCHAFAKALHYKE
LEFEQDQNSGAVEALITINNQLQQSDAAIGILRKAQAYRDVELKETWFEKLQRWDEALAA
YKRREKTDPDSFGITMGKMRCLHALGEWKVLSDLAQEKWNQASLEHRRAIAPLAAAAAWG
RGQWELMDSYLGVMKEQSPDRSFFGAILAIHRNQFDEANMYIEKARNGLDTELSALLGES
YNRAYNVVVRVQMLAELEEIITYKQNIGDPEKQDAMRKTWNQRLLGCQQNVEVWQRMLKV
RALVTAPRENLDMSIKFANLCRKSNRMGLAERSLASLETVVSDANGTRTIAPPEVTYARL
KFSWANGHQLESLEMMKEFTSGLTDDFSRYNTLMVSNGEHHGANGVNGVVDQNHPDAISL
NERIGDVNKFRKLLSKSYLRQGEWQTALQRGDWRPEHVREVLNAYSAATQYNRDSYKAWH
SWALANFEVVTTIANQASREGIPAPVPAHIVTEHVIPAIRGFIRSIALSLTSSLQDTLRL
LTLWFNHGGDHEVNTVVTEGFTAVNIDTWLAVTPQLIARINQPNIRVRGAVHRLLAEVGK
AHPQALVYPLTVAMKSNVTRRSQSASNIMESMRQHSAKLVEQADLVSHELIRVAVLWHEL
WHEGLEEASRLYFGDHNVEGMFSTLAPFHDMLDKGAETLREVSFAQAFGRDLAEAKHYCM
MYRESEEIGDLNQAWDLYYTVFRKISRQLPQLSTLDLKYVSPRLKDCADLDLAVPGTYQS
GKPVIRIMSFDPILHVLQTKKRPRRMTLKGSNGSSYMYLVKGHEDIRQDERVMQLFGLCN
TLLDNDGESFKRHLSVQRFPAIPLSQSSGLLGWVSNSDTLHALIKEYRESRRILLNIEHR
IMLQMAPDYDSLTLMQKVEVFGYAMDNTTGKDLYRVLWLKSKSSEAWLERRTNYTRSLGV
MSMVGYILGLGDRHPSNLLLDRGNGRVVHIDFGDCFEIAMHREKYPERVPFRLTRMLTFA
MEVSNIEGSYRITCEAVMRVLREHKDSLMAVLEAFIHDPLINWRLGTQESPDRVSLTADR
RQSIMDGVNFEPGAQPPGDYSRRRRPSMLEGGILDAPEGVPQEAREAQNARALQVLARVK
EKLTGRDFRNNEELSVSDQVDKLIAQATNVENICQHWIGWCSFW
NT seq 7155 nt NT seq  +upstreamnt  +downstreamnt
atggcccaagcaggtgcaatcacagacgtgacccaaagattgttcgtggagctcaagtca
aagaatgaggaggccagggccagagctgcctacgagctctacgataatgtcctatctgtg
tccagagattggccctcggagaagttcgtggaattttacaacgccgttagccaacgcatc
gcccaactcgtggtcaacggtagcgatgcaaacgaaagaatcggtggattgttagcactc
gaccgactcattgactttgacggagttgatgccgcccagaaaacgacgagattcgccagt
tacttgcgcagcgcccttcgcagtaatgataatgtggtcctggtgtatgcggcccgatcg
ctgggccgactcgcgaagcccggcggggctctaaccgcggaactggtggaaagcgaaata
caatctgcattggaatggctacaatcggagcgacaggaaagtcggcggtttgcagcagtg
cttgtgatccgggaactggccaagggctcaccaacactcctctacggcttcgttccgcag
gtatttgagcttgtctgggttgcccttcgagatccgaaagtcctcatccgtgagactgcc
gccgaggccgtcggggaatgctttgagataattgtggctcgtgattctcaagtccgtcaa
tcatggtttgcacggatacacgatgaagcacttctgggcttgaagtcccataacattgat
tggatccacggctccattttgatcatcaaagagttgatcttgaagggcacgatgtttatg
aaggaacattatcggaatgcttgcgaaatcatcctccgtctcaaggaccatcgtgaccca
aagattcgcactgaagtcgtcctcaccatccccattctcgcctcatatgccccaaccgat
ttcactgagatctatctacacaaattcatggtctacctccaagcgcaactcaagagggac
aaagagaggaactccgctttcattgccattggaaagattgccaatgcagtgggcaccgct
atcggccaatacctcgatgggatcattatctacattcgagagggacttgcaatgaaggcg
aggaatcgatcaggagttaacgaggccccaatgtttgaatgcatcagcatgctgtccctc
gcagtgggacaagcgctcagcaaatacatggaagcgcttctggatcccatttttgcctgc
gggctgagcaaatcactgacacaggctctggtcgacatggcccactacatccctcccatc
aaacccatgatccaggaaaagcttcttgatatgctgagtatcatcctttgtggaacgcca
ttccggccccttgggtgtcctgaaaaccgactacctcctatgccatcattcgcaaaagac
tttgctccccacgagcttcactccgattctgatatcgcattagcacttcatacgttagga
agctttgacttctctgggcacatactgaacgagttcgtgcgtgatgttgctatcaactac
gtggaaaatgacaatcctgaaattcgaaaagcatcggctcttacatgctgccagctgttc
gttcacgatccgatcatcaaccaaacaagcggacactccattcaggttgtcagcgaggtt
attgacaagctcttaaccgtgggtatcggagaccctgaccctgaaatccgacgcaccgtt
ttgtggtcgttggaccgcaaatttgatcgtcacttggcacgaccagagaatattcgatgc
ctgttcttagccgtcaatgatgaggttttcgacgtcaaagaagccgcgatctgcatcatc
ggtcgactttctagcgttaaccctgcttatgtcttcccgccactacgaaaactgttggtc
aatcttctcactggtcttggcttcgcgaataccgcccgccagaaggaggaaacagctcaa
ctaatcagcttgtttgtctctaatgcgacgaaattgatcaggtcatacgttgatcccatg
gtgactgccttgttgcccaaatcaacagacattaatcccggcgttgctgccactactttg
aaggctgtcggtgagctcgcaagtgtgggcgggcatgagatgagacaatatctgcctcaa
atcatgccaattattctggactcgctccaggacctttcgtcgcataacaagcgtgaagct
gcgcttcggacattgggacaattggccagcaattcaggctacgtcatcgagccatacatg
gaataccctcatcttctcgccgttctcatcaatatcatcaaaacggaacagacaggctct
ttacgcaaggagaccatcaaacttgtcggagtgctcggtgcgcttgatccctacaagtac
cagcagatcagcgagattgaacctgatgttcaccatatcaacgaaatacagaatgtttcc
gatgttgccctcattatgcagggtctcacgccctccaatgaagagtattatcccactgtg
gtcatccatactttgatgcagaacattctacgtgagaactccctggctcaatatcactca
gctgtcattgatgccatcgtcacaattttcaagactctgggcttgaagtgtgtcccgttc
cttggacaaattattccagggttcattctggttatcagaagcgctcctgctagccgcctt
gagtcctatttcaatcagatggcaatcttggtgaatatcgtgcgacaacatattcgcact
ttcctgccagagataatcgaggtcattaaagatttctgggatgcttcataccagatccaa
ggtaccattttatccttggtcgaggccattgctaggtcattggaaggagaattcaggaag
tatcttgctggcctgattcctttgatgctcgatacacttgataaagacacctcacctcgt
cgacagccctctgagaagattctccatgctcttttgattttcggctcaagcggagaggaa
tacatgcatctcatcattccttccattgttcgtctgtttgatcggccacagaatcctcag
agcatccgtaaatccgctatcgatagcttgacaaaactatcgcgacaagttaacgtctct
gactttgcatccctaatggttcattcattgtcccgagtcgtggctggcggtgatcgtgtg
ttgcgtcaagctgcgatggactgcatttgtgccctcattttccagctcggacaagacttc
acgcattacattcatcttctaaacaaggtcctaaaaaccaaccagatcgcgcataccaac
taccaaatcctggtgaccaaactccaaaagggcgacccgctcccgcaggacctcaatccg
gaagaggtctattctttccccaccgacgacaccaacttttccgaaattggacaaaagaag
attgttgtgaaccagcaacatctcaagaacgcatgggatgcttcgcaaaagtccactcgt
gacgattggcaggaatggatacgccgtttcagcattgagctgttgaaggaatcaccatct
ccggcattgcgtgcatgtgctagcttagctggtatctaccagcccctctcaagggatctt
ttcaatgctgctttcgtctcgtgctggactgagttgtatgatcaataccaagaagagctc
gtccgctcaattgaaaaggcgcttacttctcctaacatctccccagagattttgcaaatt
ctcctcaatctggccgaattcatggagcatgatgacaaggctcttcccatcgacatccgc
acacttggaaaatatgctgcaaagtgtcatgcttttgctaaagctcttcactacaaagaa
ctggagttcgaacaagaccagaactcgggtgcagttgaagccttgattaccattaacaac
cagcttcagcagtccgatgccgccatcggtatccttcgcaaagcgcaggcgtatcgtgat
gtggagctcaaggaaacttggttcgagaagctccaacggtgggacgaagcccttgctgct
tacaagcgacgtgagaagacggacccagactcatttggtatcaccatgggtaagatgcgc
tgtttgcacgctcttggcgagtggaaggttctctcggatctcgctcaagaaaagtggaac
caagcgtcactggagcaccgccgcgctattgcacctcttgccgctgccgctgcctggggt
cggggccaatgggagttgatggactcttaccttggtgtcatgaaagagcagtctccggac
cgttctttcttcggtgccattctggcaatccatcggaaccaattcgatgaggccaacatg
tacattgagaaggctcgcaatggtctcgatactgaattgtctgctcttctgggagagtca
tacaaccgtgcctacaatgttgttgtccgggtccagatgctcgccgagctagaagagatc
atcacatacaagcaaaacatcggcgaccctgaaaagcaggatgccatgcgtaaaacttgg
aatcaaagactgcttggatgtcagcaaaacgtggaagtgtggcagcgtatgctcaaggtc
agagctcttgtcacagccccgcgtgagaatcttgatatgtccatcaagttcgccaatctt
tgtcgcaagtccaatcgcatgggtcttgcggaacggtcccttgcatctctagagacagtg
gtgtccgatgccaatggcacgcgcactatcgcaccacccgaagtcacatacgccaggctg
aaattcagttgggcaaatggtcaccaactagagtcacttgaaatgatgaaggagtttacc
tctggtctgacagatgatttctccagatacaacacactcatggtatcaaatggtgaacat
catggcgcgaatggagtcaacggggtcgttgaccagaaccacccagatgccatcagcctg
aatgaacggatcggcgacgtcaacaaatttagaaaacttctctccaagagctatcttaga
cagggagagtggcagaccgctttgcagaggggtgactggagaccggaacatgttcgagag
gttctcaacgcctactcggccgcgacccaatacaaccgcgattcatacaaggcgtggcac
tcctgggcacttgcaaacttcgaggttgttacaacgattgccaaccaggctagtcgtgag
ggcatacctgcgccggttcctgctcatatcgtgacagaacatgtgattcctgccattcgc
ggattcattcgctccatcgctttgtccttgacatcttcgttgcaagataccttgagatta
ctcactctgtggtttaatcatggcggagatcatgaggtaaacactgtcgttacggaagga
tttacggctgtcaatatcgacacttggctcgctgtcactcctcaactgatcgctcgaatc
aaccaacccaatatcagggtccgcggtgcggttcataggttgcttgccgaggttggcaaa
gcgcatcctcaagcccttgtgtatccactgacggtggcaatgaaatcgaatgtgactcga
cgctctcaatctgctagcaacatcatggaaagtatgcggcaacatagcgccaaacttgtt
gagcaagcagatcttgtgagtcatgagcttatccgagttgcggtcttgtggcatgaactt
tggcatgaaggtctcgaagaagcgtctcgtctctatttcggcgatcacaatgttgaaggc
atgttctcaacacttgcgcccttccatgatatgctagacaagggcgccgagacccttcgt
gaggtgtcatttgcgcaagctttcggtcgtgaccttgctgaagccaagcattactgcatg
atgtatcgcgaatcggaggaaatcggtgatctcaaccaagcttgggacttgtattacact
gtgttccggaagatcagccgacagctaccacagctatcgactctcgatcttaaatacgtg
tctcctcgactcaaggattgcgcagaccttgaccttgccgttccaggaacataccagagt
ggcaagccagttattcgaatcatgagcttcgacccgatcttgcatgttttgcagacaaag
aaacgaccgcgtcgcatgacgcttaaaggcagcaacggtagctcttacatgtaccttgtc
aagggccatgaagatatccgacaagatgagcgagtcatgcaacttttcggcttgtgtaat
accttgctggataacgatggcgagagtttcaagcggcacttgtcggtccagcgtttccct
gccattccattgtctcagagctctggtctcctgggatgggtgtccaacagtgatacattg
catgccttgatcaaggaataccgtgaaagccggagaatcctactcaacatcgagcatcgg
atcatgcttcaaatggcacccgactacgatagccttactctcatgcagaaggtcgaagta
ttcggttacgctatggacaacacgaccggcaaagatctgtaccgcgtgctatggcttaag
agcaagagctctgaggcatggcttgaacgtcgtacgaactacactcgatcgctcggtgtt
atgtctatggtcggctacatccttggtctgggagacaggcatccatcgaacttgctgctg
gatcgtggtaatggccgtgtggttcatatcgactttggtgattgtttcgagatcgcaatg
caccgagagaaatacccagagcgagttccgttccgacttactcgcatgttgacgttcgcc
atggaagtcagcaacattgagggtagctaccgtatcacttgcgaggctgtcatgcgtgtt
ctacgagagcacaaggattccctgatggcagttttggaggctttcatccacgaccctcta
atcaactggcgtctgggtacacaagagtctcccgaccgagtgtctctcactgcggatcgc
cgccagtccatcatggacggtgtcaatttcgaacccggcgcccagccgcccggcgattat
tcgcgtcgccgccgcccatccatgcttgaaggtggtatcctcgacgccccggaaggcgtt
ccacaagaagcccgcgaggcacagaatgcccgtgctctccaggttctcgcccgagtcaag
gagaagctcactggacgagacttcagaaataacgaagagctgagtgtcagcgaccaggtg
gacaagctcattgcgcaggcaaccaatgttgagaatatctgtcaacactggattggatgg
tgtagtttctggtaa

DBGET integrated database retrieval system