KEGG   Penicillium chrysogenum: Pc22g20860Help
Entry
Pc22g20860        CDS       T01091                                 

Definition
Pc22g20860
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
pcs  Penicillium chrysogenum
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Pc22g20860
Enzymes [BR:pcs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Pc22g20860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 720 aa AA seqDB search
MKPSWLGWSLLSLLVAPALGTPSDASSDQESGDALVKRGGRGVDSDTPTTFNDIKVPPLT
QLTPENFEEVTKDGYWMIKHYSPTCPHCRTAAPMYQTLYEYYYTSNPLFLSGLKPGELAS
LDSFTGYYNLHFGSINCLAFGDFCTKLNVEFFPAWAFYDMGVQNGRPVGAKTMSEIAAMI
EAKLETIKPGSRPSQGVQIPKAGAKSMEMTAKPEVVKPGAKTAVEKQSIETAELEGVSPE
SVKAKLQGRPANPQGVSIPLTAESFQSLVTTTHDPWIIKFYVPWCHHCQALAPNWNSMAK
EMKDTLNVGEVNCDLEKRLCEDARVNAYPTIYFFRGGERVEYTGLRGLGDLIAYTNKAVG
VGSSIQDVDATTFKRLEETEEVLFLYLYDHATTSEDFEAMNRLTLSLVGHARIVKSDSAA
LSERFKISTWPRLLVVRDGRPNYYNALAPKDMRDFRQILSWMQTVWLPIVPELTASNAQE
IMNGKFVVLGLLSRRRSDDFKQSKRELKEAALEWMDKQVQLFRLERAELRDSKQLRIEEA
DDRNDQRALRAAKNMRITIREDDKKQVAFAWVDGDFWERWLRTTYGIDVENSDRVIINDQ
DNRRYWDTASSGAPIMASRTSILETIPLVVASPSKLSPKSTIGTFETILFFTRSLLGSHP
ILFFIILGAVVAVATIFGRGRLRRGAARGGIIGNTNNNGGFFHLDGKEGFLNGGSTDKVD
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgtcttggctggggtggtccctcctctcactgttggtagcgcctgctttgggc
acgccttcagatgcttcctccgaccaagaatctggagatgcacttgtcaagaggggaggt
cgcggagtggattccgacacccccacaacattcaatgatatcaaagtgcccccgttgacg
cagctgacccccgagaatttcgaggaagtgaccaaagatggttactggatgattaaacat
tattcccccacctgtccgcattgccgcacggccgctccaatgtaccagaccctgtacgag
tactactacacctcaaatcccttattcctctccggactgaagcccggggagctcgcctct
ctggactcgtttaccggctactataatctccatttcgggtcgataaactgcctggccttc
ggcgatttctgcacgaagttgaacgtcgaattcttccccgcgtgggcattctacgatatg
ggcgttcagaacggacgccctgttggtgccaagacgatgtcagagattgccgctatgatt
gaagccaagctcgagacgatcaagcctgggtcccgaccttcgcaaggcgtccaaatccca
aaggccggcgctaagagcatggaaatgactgccaaacctgaagtggtgaagcctggcgcg
aaaacagctgtcgagaagcagagcatcgaaaccgcagaattggaaggcgttagcccagaa
tctgtcaaggccaagctccaaggacggcctgctaatccccagggtgtttccatcccactc
actgctgaaagcttccaaagtctcgtaacgactacacatgatccctggatcattaagttt
tacgtcccttggtgccatcattgccaggctctggccccgaattggaactcgatggccaag
gaaatgaaggataccctcaatgttggcgaagtgaactgcgatcttgagaagcgactgtgt
gaggatgctcgcgtgaatgcctacccaacgatctacttcttccgtggcggcgaaagagtt
gaatataccggtcttcgtggcttgggagatctgatcgcgtacaccaacaaagccgtcggt
gtgggctcgagcattcaggatgttgacgcgactacttttaagcggttggaagaaaccgaa
gaggttttgttcttgtatctctacgaccacgcgactacgtctgaagattttgaggctatg
aaccgcctcaccctcagtcttgtgggacacgctcgcattgtcaagtccgacagtgctgct
ctttccgagcggttcaagatctctacctggccgcgtcttctggtcgtccgtgacggacgt
cccaactattacaatgcccttgctcctaaggacatgagagatttccgtcagattctctcg
tggatgcaaactgtgtggctgcccatcgtacctgagctcaccgcatccaatgcgcaagaa
atcatgaatggaaagttcgtcgttctgggactcctcagccggcgccgtagcgatgacttc
aagcaatctaagcgcgagctgaaggaagccgcccttgaatggatggacaagcaggttcaa
ttgttccgccttgagcgggctgaacttcgtgattccaagcaactgcgtatcgaagaagcc
gatgaccgtaatgatcagcgtgcactgcgggctgcgaagaacatgcgtattacgatccgc
gaggacgacaagaagcaagtcgcattcgcctgggtcgatggcgacttctgggagcgctgg
ctgcgaacaacttacggcatcgacgtggagaacagtgaccgcgttattatcaatgatcaa
gataaccgccgctactgggatactgcttcaagtggagctcctattatggcctcgcggacc
tccattctcgagaccattcctctcgtcgtcgcttccccttcgaagttgtcacccaaatct
accatcggcacctttgagactatcttattcttcactcggtctctcctcggcagtcaccct
attctcttcttcattatcttgggtgccgttgttgctgtggccaccattttcgggcgtgga
cgccttagacgtggtgctgcgcgcggcggcatcattggcaacaccaacaacaacggtggc
ttcttccacctggacggcaaggagggtttcctcaatggaggctcgaccgacaaagtcgac
taa

DBGET integrated database retrieval system