KEGG   Penicillium rubens: Pc22g20960Help
Entry
Pc22g20960        CDS       T01091                                 

Definition
(RefSeq) Pc22g20960
  KO
K00365  urate oxidase [EC:1.7.3.3]
Organism
pcs  Penicillium rubens
Pathway
pcs00230  Purine metabolism
pcs00232  Caffeine metabolism
pcs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Pc22g20960
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    Pc22g20960
Enzymes [BR:pcs01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     Pc22g20960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Uricase Mob_Pre SnoaL_2
Motif
Other DBs
NCBI-GeneID: 8305238
NCBI-ProteinID: XP_002565993
UniProt: B6HS12
AA seq 302 aa AA seqDB search
MSALAAARYGKDNVRVCKVHRDEKTGIQTVVEMTVCVLLEGDIETSYTKADNSVVVATDS
IKNTVFITAKQNPVTPPELFGSILGTHFIEKYSHIHAAHVNIVTHRWVRMDIDGKPHPHS
FIKPGTETRDVQVDVIEGKGIDINSAINGLTVLKSTGSQFWGFVRDEYTTLKETWDRILS
TDVAANWQWRRFTGLAEVKAHFEKFNAAWEAARAITLKTFAEDNSASVQATMYKMGEQIL
AAAPLLDTVSYALPNNHFFEIDLSWHKGLKNTGKDAEVYAPQSNPNGLIKCTVARSGQKA
KL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcattggcagctgcccgctacggcaaagacaatgtccgcgtgtgcaaggtgcac
cgcgatgagaagactggtatccagactgtcgtggagatgaccgtgtgtgtcctgttggag
ggcgatattgagacctcttacaccaaagccgacaacagcgtcgttgtcgcaaccgactcg
attaagaataccgtcttcatcacagccaagcagaaccccgtaacaccaccggagctgttc
ggctcaatcctgggcacacacttcatcgagaagtacagccacatccacgcggcgcatgtc
aatatcgtgacccaccgctgggtgcgcatggacatcgatggcaagccgcacccgcactcg
ttcatcaagcctggcaccgagacgcgcgacgtgcaagttgacgttatcgagggcaagggc
atcgacatcaactccgccatcaacggactgaccgtgctgaagagcaccggttcccagttc
tggggcttcgttcgcgacgagtacaccactctcaaggagacctgggaccgtattctcagc
accgatgtcgcggcgaactggcagtggcgccgcttcactggtctcgccgaggtcaaggcg
cactttgagaagttcaatgctgcttgggaggcggcccgcgctattaccctcaagaccttt
gctgaggataacagtgcctccgtccaggcgacgatgtataagatgggagagcagattctt
gctgctgcgcctctgctggatactgtttcgtatgcgttgcctaataaccacttcttcgaa
atcgatctcagctggcacaagggcctcaagaacaccggcaaggacgccgaggtgtacgct
ccccaatccaaccccaacggtcttatcaagtgcaccgttgcccggtctggccaaaaggct
aagctgtaa

DBGET integrated database retrieval system