KEGG   Penicillium chrysogenum: Pc22g20960Help
Entry
Pc22g20960        CDS       T01091                                 

Definition
Pc22g20960
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
pcs  Penicillium chrysogenum
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pcs00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism [PATH:pcs00232]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 302 aa AA seqDB search
MSALAAARYGKDNVRVCKVHRDEKTGIQTVVEMTVCVLLEGDIETSYTKADNSVVVATDS
IKNTVFITAKQNPVTPPELFGSILGTHFIEKYSHIHAAHVNIVTHRWVRMDIDGKPHPHS
FIKPGTETRDVQVDVIEGKGIDINSAINGLTVLKSTGSQFWGFVRDEYTTLKETWDRILS
TDVAANWQWRRFTGLAEVKAHFEKFNAAWEAARAITLKTFAEDNSASVQATMYKMGEQIL
AAAPLLDTVSYALPNNHFFEIDLSWHKGLKNTGKDAEVYAPQSNPNGLIKCTVARSGQKA
KL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcattggcagctgcccgctacggcaaagacaatgtccgcgtgtgcaaggtgcac
cgcgatgagaagactggtatccagactgtcgtggagatgaccgtgtgtgtcctgttggag
ggcgatattgagacctcttacaccaaagccgacaacagcgtcgttgtcgcaaccgactcg
attaagaataccgtcttcatcacagccaagcagaaccccgtaacaccaccggagctgttc
ggctcaatcctgggcacacacttcatcgagaagtacagccacatccacgcggcgcatgtc
aatatcgtgacccaccgctgggtgcgcatggacatcgatggcaagccgcacccgcactcg
ttcatcaagcctggcaccgagacgcgcgacgtgcaagttgacgttatcgagggcaagggc
atcgacatcaactccgccatcaacggactgaccgtgctgaagagcaccggttcccagttc
tggggcttcgttcgcgacgagtacaccactctcaaggagacctgggaccgtattctcagc
accgatgtcgcggcgaactggcagtggcgccgcttcactggtctcgccgaggtcaaggcg
cactttgagaagttcaatgctgcttgggaggcggcccgcgctattaccctcaagaccttt
gctgaggataacagtgcctccgtccaggcgacgatgtataagatgggagagcagattctt
gctgctgcgcctctgctggatactgtttcgtatgcgttgcctaataaccacttcttcgaa
atcgatctcagctggcacaagggcctcaagaacaccggcaaggacgccgaggtgtacgct
ccccaatccaaccccaacggtcttatcaagtgcaccgttgcccggtctggccaaaaggct
aagctgtaa

DBGET integrated database retrieval system