KEGG   Penicillium chrysogenum: Pc22g21270Help
Entry
Pc22g21270        CDS       T01091                                 

Definition
Pc22g21270
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pcs  Penicillium chrysogenum
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pc22g21270
   01212 Fatty acid metabolism
    Pc22g21270
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Pc22g21270
   00650 Butanoate metabolism
    Pc22g21270
  Lipid metabolism
   00062 Fatty acid elongation
    Pc22g21270
   00071 Fatty acid degradation
    Pc22g21270
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Pc22g21270
   00310 Lysine degradation
    Pc22g21270
   00380 Tryptophan metabolism
    Pc22g21270
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Pc22g21270
Enzymes [BR:pcs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Pc22g21270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 293 aa AA seqDB search
MFARQCTRLATSRTSAPLTSYLARVRGYSSAAGSYEHILTSTPKPGVGLITLNRPKALNA
LCSPLFKELNEALSNYDNDKSIGAIIITGSEKAFAAGADIKEMAPLSFSAAYSDNFIAPW
SHLATSIRTPVIAAVSGYALGGGCELALMCDILYCSENATFGQPEIKLGTIPGAGGSQRL
TRAIGKSKAMELILTGKNFSGKEAGEWGVAAKVVPGGKEELLEQAYKTAETIASYSRVAV
VAGKEVVNKSQELSLKEGVEYERRLFHALFGSKDQKIGMTAFAEKKKPEWSHE
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcccgtcaatgcactcgtctggccacttcccggacatcggcccccttgacttcc
tacctagcccgagtccggggttattcttcagctgctggtagctacgagcacatcctcacc
tcgacccccaagcccggtgtgggattgattacccttaaccgccctaaggccctcaacgca
ctatgctctccattgttcaaggagcttaatgaagccctgagcaactacgacaatgacaag
agcatcggcgcgattattataactggaagcgagaaggcctttgccgccggggccgacatc
aaagaaatggcccctctaagcttctccgccgcctacagcgacaacttcattgcgccctgg
tcccacctcgccacctccatccgcaccccagtcatcgccgccgtctctggctacgccctc
ggcggcggctgcgagctagccctgatgtgcgacatcctgtactgctccgaaaatgccacg
ttcggccagccggagatcaagctcggcacgatccccggcgcaggcggctctcagcgcctg
acccgtgcgatcggcaagagcaaggccatggagcttatccttaccggcaagaacttcagc
ggtaaggaggctggtgagtggggtgttgcggcgaaggttgtgccgggtggtaaggaggag
ctgcttgagcaggcgtataagacagctgagactattgccagctatagccgtgtggctgtt
gttgctggtaaggaggttgttaataagagtcaggagttgtcgctcaaggagggtgttgag
tatgagagacggttgttccatgcgctctttggcagcaaggatcagaagattggtatgact
gcctttgcggagaagaagaagcctgagtggtcccatgaatag

DBGET integrated database retrieval system