KEGG   Penicillium chrysogenum: Pc22g22240Help
Entry
Pc22g22240        CDS       T01091                                 

Definition
Pc22g22240
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
pcs  Penicillium chrysogenum
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Pc22g22240
Translation factors [BR:pcs03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    Pc22g22240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 742 aa AA seqDB search
MAPSFDTLSEQDLHEEEEEEIDFSDLKEQYEVKVEEGLDTFIVIDGLPVVPEDSRQKLVK
FLLRKLNSVGSTSEDAVFMPVNDKKMTEGFAFVEYETPEMAVAAVKQLHGVPLDKKHIMA
VNKLMDIERYGREGRVEEEYKAPAPEPFKEKEHLRSWMGDANARDQFALYRNDKVGVFWN
NKTNPPENVVDRAHWTQLFVQWSPKGTFLASVHPQGVQLWGGESFSKQKQFPHPFVQLIE
FSPLEGYLTTWSARPIQVEEGQPILTYEEDGKNIIVWDIETGKPLRSFVSHDLAAPTEIE
GEVAPKKKVQWPAFKWSADEKYVARMLQGQSLSIYELPNMNLLGRTSVKIEGAMDFEWSP
ATVAREGVKQYEQLLCFWTPEIGSNPARVGMMSVPSKEIVRTRNLFNVSDVKLHWQSQGA
YVCVKVDRHSKSKKSMATNLEIFRVREKGVPVEVVDSLKDTVINFAWEPNGSRFVVIANG
ETPTGAAVLPKTSVSFFAPEKKGHTAGNFKLVRTIEKKTSNGIYWSPKGRFVVVATVHSQ
TNFDLDFWDMDFEGEKIEAEKDLAANLQLMKTVEHYGVTDVDWDSTGRYVVSSASVWTHS
MENGWNMHTFSGTTLSENPTEKFKQFLWRPRPATLLSKEEQKQVRKNLREYSKEFEEEDK
YAVDIANTAVVETRKRVLSEWLAWLRREKELLAEEKEAFTLPENADTPAAAGDARPVVED
QGDSVVEEIVEEIIEETEEVIG
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccagtttcgacaccctgtctgagcaggatctccacgaggaagaggaggaggag
attgatttctccgatctcaaggagcaatatgaagtgaaagttgaggagggactggataca
tttatcgtcatcgatggcctccccgttgtgcccgaagatagccgacaaaaactcgtcaag
ttcttattgagaaaactcaactccgtcggcagcacctccgaagatgcggttttcatgccc
gttaacgacaagaaaatgaccgaagggttcgcctttgtggaatatgaaaccccggaaatg
gcagttgccgccgtcaagcagttgcacggcgtccctctcgataagaagcacattatggct
gtcaacaagttgatggatatcgagcgttatggtcgcgaaggtcgggtcgaggaagaatac
aaggcacccgccccggagccgttcaaggagaaggagcacctgcgctcgtggatgggagat
gccaacgcccgtgatcaattcgccctttaccgtaacgacaaggtcggtgtgttctggaac
aacaagacaaacccacctgagaatgtcgtggatcgcgctcactggacacaactgttcgtt
caatggtcccccaagggtacattccttgcctccgtccacccccagggtgtccagctctgg
ggcggagagtccttctccaagcaaaagcagttccctcaccccttcgtgcagttgatcgag
ttctccccgcttgagggctacttgacaacttggtcagcacgacccatccaggtcgaggaa
ggccaacctatattgacttacgaggaagacggcaagaacattattgtctgggatattgag
actggcaagcctctccgttcgttcgtgtcgcacgacttggctgcccctaccgagatcgag
ggcgaggttgcacctaagaagaaggtgcagtggcctgccttcaagtggtccgcggacgag
aagtacgttgctcgcatgctccagggtcaatccctctctatctacgagcttcccaacatg
aaccttcttggtcgcacttcggtgaagattgagggtgctatggacttcgagtggtcccct
gccaccgtcgcccgcgaaggtgtcaagcagtacgagcaattgctctgcttctggactcct
gaaatcggcagcaaccctgcccgtgtcggtatgatgagcgtgccctcaaaggagatcgtc
cgaacccgtaacctgttcaacgtttccgatgtcaagctgcactggcaatcacagggtgcc
tacgtctgtgtcaaggttgaccgtcactccaagtcgaagaagtccatggctactaacttg
gaaatcttccgcgttcgcgagaagggagtgcccgttgaggttgttgacagcctcaaggat
actgtgattaactttgcctgggagcccaatggatcccgattcgtcgttatcgccaacggc
gaaacaccaactggtgctgccgtcctccctaagacttccgtctcattcttcgcgcctgag
aagaagggccacactgccggtaacttcaagttggtgcgcactattgagaagaagaccagc
aacggcatctactggtcgcccaagggccgattcgttgttgtcgcgacggttcactcccag
actaacttcgatctggacttctgggatatggacttcgagggcgagaagatcgaggctgag
aaggatctcgcagccaacctccagctgatgaagaccgtcgagcactacggtgtcaccgat
gttgactgggactccactggtcgttacgttgtcagcagcgccagtgtgtggactcactcg
atggagaacggctggaacatgcacaccttctccggcactaccctctccgagaaccccacc
gaaaagttcaagcagttcctttggcgcccacgccctgccactcttctcagcaaggaggag
cagaagcaagttcgcaagaacctccgcgagtactcaaaggagttcgaggaggaagacaag
tacgctgtcgatatcgccaacaccgccgttgtcgagacccgcaagcgtgtactcagcgaa
tggctcgcctggctccgtcgggagaaggagctcttggccgaagagaaggaggctttcacc
ctccccgagaacgcagatacacccgcggccgctggcgacgcgcgcccggttgtcgaggac
cagggcgattccgtggtcgaggagattgtggaggagattatcgaggagaccgaggaggtc
attggctga

DBGET integrated database retrieval system