KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_0140Help
Entry
PC1_0140          CDS       T00934                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PC1_0140
   01230 Biosynthesis of amino acids
    PC1_0140
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PC1_0140
   00030 Pentose phosphate pathway
    PC1_0140
   00051 Fructose and mannose metabolism
    PC1_0140
   00052 Galactose metabolism
    PC1_0140
  Energy metabolism
   00680 Methane metabolism
    PC1_0140
Enzymes [BR:pct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PC1_0140
Protein phosphatases and associated proteins [BR:pct01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PC1_0140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
166464..167426
Genome map
AA seq 320 aa AA seqDB search
MIRRIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVYGIYDGYQGLYEDRMEQLDRYSVSD
VINRGGTFLGSARFPQFRDEAVRQVCVENMKRRGLDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDVAGTDYTIGYFTALETVLEAIDRLRDTSSSHQRISIVEVMGRHCGDLTLA
AAIAGGCEFIVLPEVPFSPEDLVCEIKAGIEKGKKHAIVAITELVCDVDELAKYIEKETG
RETRATVLGHIQRGGSPVAYDRILASRMGAYSIELLQQGYGGRCVGIQNEKMVHHDIVDA
IENMKRPFKGDWLDTAKKLF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattagaagaatcggagtgttgacgagcggtggcgatgcaccaggtatgaatgcggca
attcgtggtgtggttcgcgctgcactaacggaagggctggaagtttacggcatttatgat
ggttatcagggcttgtacgaagatcgcatggagcagttggatcgctacagcgtatcggat
gtgattaaccgtggcggcacgtttctgggatctgcgcgtttcccgcagtttcgtgacgaa
gcagtgcgtcaggtttgcgtagaaaatatgaaaagacgcggtctggatgcgctggttgtt
atcggcggtgatggttcctatatgggggctaaacgtctgaccgaaatgggtttcccttgt
atcggcttgcccggcacaatcgataacgatgtggcgggtacggactacacgatcggctac
tttaccgcgctggaaaccgtgctggaagcgattgaccgcctgcgtgatacctcctcttca
caccagcgtatttccattgttgaagtcatgggacgccactgcggtgacctgacgctggcg
gcggcgattgccggcggttgtgaattcatcgttctgccggaagtgccgttcagcccggaa
gatctggtctgtgaaatcaaagcgggtatagagaaaggcaaaaaacacgcgattgtggct
atcactgaactggtgtgcgacgtcgacgagctggcgaaatacattgaaaaagaaacgggg
cgcgaaacccgtgcgaccgtactcggccacattcagcgcggtggttctccggttgcatat
gaccgcattctggcttcgcgcatgggtgcctactctatcgagttgctacagcaaggctac
ggtggccgctgcgtcggtatccagaatgaaaaaatggtgcaccatgacatcgttgacgcc
atcgagaacatgaaacgtcctttcaaaggcgattggctggatacggcgaaaaagctgttc
tga

DBGET integrated database retrieval system